A History of the Kalacakra in Tibet and a Study of the Concept of Adibuddha

Studies in the Kalacakra Tantra

A History of the Kalacakra in Tibet and a Study ofthe Concept of A.dibuddha, the Fourth Body of the Buddha and the Supreme Unchanging

Urban Hammar

STOCKHOLM 2005

Department of Ethnology, History of Religions, and Gender Studies History of Religions S-10691 Stockholm

ACKNOWLEDGEMENTS

1. INTRODUCTION.

1.1. TANTRlC BUDDHISM. 1.1.1. The Kalacakra Tantra. 1.2. METHODS AND AIMS. 1.3. A SHORT SURVEY OF EARLIER RESEARCH ON THE KALACAKRA TANTRA.

1.4. THE KALACAKRA IN CONTEMPORARY CONTEXT. REASONS WHY KALACAKRA IS IMPORTANT TODAY.

2. THE EARLY mSTORY OF KALACAKRA IN TIBET. 2.1. THE ORlGIN OF KALACAKRA IN SHAMBHALA AND INDIA. 2.2. THE INTRODUCTION AND DEVELOPMENT OF KALACAKRA IN TIBET. 2.2.1. On the dates of the introduction of Kalacakra to Tibet.

2.2.1. a. The first mention ofthe translators of the Kiilacakra Tantra.

2.2.2. Concerning the early history of Kalacakra in Tibet. An introduction to and analysis of Bu-ston' s "A History of Kiilacakra." 2.2.3. Bu-ston' s text: Dus-khor 'chos 'byung - " A history of Kalacakra."

26 34

2.2.3.a. Guru-lineages derived from A History ofKiilacakra" by Bu-ston and "The Blue Annals, " by 'Gos lo-tsa-ba gZhon-nu-dpal.

61

2.3. CONCLUSIONS.

3. SURVEY OF THE KALACAKRA TEXTS AND THEIR CONTENT. 3.1. THE BASIC TEXTS TREATING THE KALACAKRA TANTRA.

3.2. SOME REMARKS ON THE CONTENT OF THE SRl-KALACAKRA-TANTRA-AAJA AND THE VIMALAPRABHA..

3.2.1. Kalacakra and its relation to the MafijusrI-nama-sanglti. 3.2.2. The concept of Time (kiila) in the Kiilacakra-tantra. 3.2.3. On Shambhala and the battle between Raudra Kalkin and the barbarians in the outer and the inner. The micro/macro-perspective in the Kalacakra.

3.2.3.a. The information on Shambhala in the verses KCT 1:150-170. 3.2.3.b. The history of Shambhala and the outer battle in Sri-Kiilacakranlima-tantra-riija, chapter L verses 150-170. 3.2.3.c. The inner battle in Sri Kiilacakra-niima-tantra-riija and the VP, chapterIl-Adhyiitma-patala, verses 48-50.

4. THE ADIBUDDHA CONCEPT. ITS USE AND MEANING IN THE KALACAKRA. 4.1. EARLIER RESEARCH ON THE ADIBUDDHA CONCEPT. 4.2. THE ADIBUDDHA CONCEPT IN THE KALACAKRA TANTRA.

4.2.a. Introduction to the texts. 4.2.b. Adibuddha.

4.2.1. Adibuddha in the SrI-Kiilacakra-tantra-riija and the Vimalaprabhii. 4.2.1.a. Adibuddha in the Sri-Kiilacakl'a-tantra-riija (KC1) and the Vimalaprabhii (VP) commentary to chapter I - Lokadhiitupara1a/:z - the chapter on the outer world. 4.2.1.b. Adibuddha in the KCT and the Vimalaprabhii commentary to chapter II - Adhyiitmaparala/:z - the chapter on the inner world. 4.2.1.c. Adibuddha in the KCT and the Vimalaprabhii commentary to chapter III - Abhi~ekapatala/:z - the chapter on the initiation. 4.2.1.d. Adibuddha in the KCT and the Vimalaprabhii commentary to chapter IV - Siidhanapara1a/:z - the methods ofpractice chapter. 4.2.1.e. Adibuddha in the KCTand the Vimalaprabhii commentary to chapter V - Jiiiinapatala/:z - the chapter on knowledg~. 4.3. ADI BUDDHA IN THE BASIC KALACAKRA TEXTS - A CONCLUDING SURVEY. 4.3.a. Adibuddha in the the Sri-Kiilacakl'a-niima-tantra-riija (KC1) 4.3.b. Adibuddha in the Vimalaprabhii (VP) 4.3.c. Kiilacakra in the Vimalaprabhii. 4.3.d. Visvamiita in the Vimalaprabhii. ,4.4. CONCLUSIONS. 5. THE FOUR BODIES OF THE BUDDHA IN THE KALACAKRATANTRA, AND THEIR RELATION TO THE ADIBUDDHA CONCEPT.

5.1. INTRODUCTION . EARLIER RESEARCH ON THE FOUR BODIES OF THE BUDDHA. 141 5.2. THE 88FOURTH BODY OF THE BUDDHA]] IN THE KALACAKRA TEXTS. 145 145 5.2.1. The four bodies in the introductory parts of the Vimalaprabhii. 5.2.2. The fourth body as suddhakiiya and sViibhiivikakiiya in the Kalacakra texts. 148 5.2.3. Sahajakiiya as the supreme body. 155 5.2.3.a. The subchapter on the four bodies, KCT V:89-90, the corresponding Vimalaprabha and Tibetan commentaries. 159 169 5.3. CONCLUSIONS. 6. PARAMAKf:;ARA - THE SUPREME UNCHANGING. ITS RELATION TO THE ADI UDDHA CONCEPT AND THE SAHAJ'AKAYA.

6.1. THE SUPREME UNCHANGING AS PRESENTED IN KCT V: 127 AND THE VlMALAPRABHA COMMENTARY. 6.1.1. T4e third subchapter of chapter V: Pararniik~ara-jfiiina-siddhi The perfection of knowledge of the supreme unchanging. 6.1.2. Commentary. What is the concept of the paramiik~ara, the supreme unchanging? 6.2. CONCLUSIONS - THE RELATION OF PARAMAK~ARA (THE SUPREME UNCHANGING) TO SAHAJAKA.YA AND THE AD/BUDDHA. 6.2.1. Some remarks on the last part of the commentary on KCTV:127.

APPENDIX 1. The Tibetan text of Zhang zhung chos dbang grags pals commentary on KCT V: 89 on the four bodies. APPENDIX 2. Table of contents of the KCT and the Vimalaprabha.

APPENDIX 3. The commentarial texts on the Kalacakra Tantra in the bsTan-lgyur.

ACKNOWLEDGEMENTS. The Kalacakra Tantra was during my years ofTibetological studies in Paris in the 1970s, a generally little studied form of Buddhism. When I later learned about the Kalacakra TanIra I found

it very complicated and fascinating. Consequently, it was a challenge for me to initiate a project on this lanlric Buddhist teaching. Primarily, I wish to thank Professor Per-Arne Berglie who with his patience and creative ideas has been an invaluable source of support. Docent Erik afEdholm has over the years provided much valuable criticism and practical advice. I also received continued support from Professor emerita Gunilla Gren-Eklund in whose Department of Indology ofUppsala University I made my Sanskrit studies. To the late Klas Hagren, lecturer in Sanskrit at Uppsala University, lowe a great debt from

all the hours we worked with the Kalacakra texts in Sanskrit and Tibetan. This work provided the basis for my textual studies. The late Geshe Lharampa Tarab Tulku was of invaluable help for the translation of [[Bu-

ston's]] text of the history of Kalacakra. I also want to thank Professor John Newman for s~nding me his dissertation and putting me in contact with David Reigle, who then sent me the, then still not published, Sanskrit manuscript of the fifth chapter of the Kalacakra TanIra. I also want to thank Professor Peter Schalk ofUppsala University who supported me in the beginning of this project. I

later received support from Professor Tord Olsson of Lund University. The members of the doctorate seminar of the Department of History of Religions at Stockholm University

have provided valuable criticism that I have appreciated. Many thanks to James Ellerson who revised my English language and to Kristian Pettersson who designed the cover and changed my guru lineages into readable

form. Many other persons have been of importance for this work and I thank them all. Finally, thanks to Maribel and my sons Daniel, Victor and Emil for their patience and for existing.

INTRODUCTION

1.1. TANTRIC BUDDHISM. Tantric or Vajrayiina Buddhism is a development of the earlier Mahiiyiina Buddhism and can be dated to approximately the 5th or 6th century AD. This dating is controversial as it is quite difficult to fix a date for the earliest tantric texts. Buddhist Tantric texts and practises appeared in Tibet from the i h century. The Kalacakra Tantra appeared in India at the beginning of the 11 th century and very soon after, in Tibet. The importance of these teachings in Tibet is underlined by the

fact that the Tibetan calendar has as its date of origin the year 1027 AD, which is the traditional year of the introduction of the Kalacakra Tantra to Tibet. Tantric Buddhism has the same basis as Mahiiyiina Buddhism in the importance of compassion and the ideal of the bodhisattva. The difference lies more in the methods applied for reaching the goal of Nirviil}a, Sunyatii (voidness) or Mahiisukha, "the great bliss", as it is more often called in the texts. In Vajrayiina Buddhism the most important practice is the siidhana rituaL The word siidhana means "method or means" and it is a method of reaching contact with

the chosen buddha, bodhisattva or protective deity. The ritual is based on a written text and the bodhisattva is described and visualised in front of the practitioner. At some moment of the recitation the reading is halted and the mantra of the bodhisattva is recited. Then the reading of

the text is resumed and the practitioner is finally identified with the chosen deity. Another difference with Mahiiyiina Buddhism is that in Vajrayiina Buddhism there exists a possibility to reach Nirviil}a in one lifetime with the help of special methods like the six-fold yoga ofthe Kalacakra Tantra.

1.1.1. The Kalacakra Tantra. Kalacakra means "The wheel oftime", and in some ways it is a philosophy oftime. At the beginning of the basic text it is mentioned that everything in the cosmos has its origin ih

"time".l The basic extant texts are the relatively short Srf-Kalacakra-tantra-riija (KCT) and its canonical commentary Vimalaprabhii (VP). It is said that there exists a root-tantra, which is much longer, but of which only a shorter text and various quotations are known. There are also many other

texts translated from the Sanskrit into Tibetan in the Tibetan canon, the bKa '-gyur and the bsTan- 'gyur. Finally, there is a voluminous literature of commentaries written in Tibetan from later centuries. The great number of texts is a measure of the importance of the Kalacakra Tantra in Tibet. Only

parts of this literature are translated into western languages. According to their own tradition, the basic texts were written by kings in the mythic land of Shambhala. 2 Buddha Siikyamuni himself is supposed

to have preached the original root tantric texts, whi.ch then have been written down by the kings of Shambha/a. The basic text (KeT) and its commentary (VP) are divided into five chapters among which the first treats

the outer world (the macro-cosmos) and the second chapter the human inner world (the micro-cosmos), consisting of the subtle body with the six cakras and how to control this body. There is a description of the subtle body as a system of energy (pralJa) channels with three main channels, one in the middle (avadhiiti), and one on each side. The energy is moving in these channels and the goal of the [[six- limb yoga]] (~a4aizga-yoga) is to halt the movement of these "winds" and in that way reach the state of the supreme unchanging bliss. The energy is not moving in the spine as in Hindu KUlJ4alini yoga, but somewhere in the middle of the body. The third chapter (abhi~eka-para/a) treats the

initiation ritual of this tantric system. This chapter was the first to be explained by the Dalai Lama as it was necessary to shed· light on the Ka/acakra initiations that he was giving since the 1970s. 3 The fourth chapter contains descriptions of the methods of meditation (sadhana) and also

the six-limbed yoga mentioned above. The fifth chapter (jiiana-para/a) treats the knowledge (jiiana) with a long sub-chapter on the supreme unchanging bliss. Traditionally, the Ka/acakra Tantra is divided into three parts, the outer, which is the first chapter treating astronomy, astrology and

mathematics; the inner, which is the second chapter treating the human body with its inner structure of cakras and different energy channels. Finally there is the "other" Kalacakra which in chapters 3-5 treats the very divinity Kalacakra, the malJ4ala and the other main teachings. The teachings

of Ka/acakra have as a goal to reach nirvalJa, or rather the state of siinyata (the void) also called the state of great bliss (mahasukha) which can be compared to the concept of the supreme unchanging (paramak~ara). This is reached by the union of opposites as mentioned in other [[mahayana

teachings]], male/female, upayaJprajiia translated as means and wisdom. This state is symbolised by Ka/acakra (the wheel of time) as a male divinity in embrace with his female counterpart Visvamata (the all-mother). These two in union possibly emerge from the so-called Adibuddha, the "original"

Buddha, or the "first Buddha". Actually, it is not very clear what is meant by the concept of Adibuddha. In some places it can be interpreted as the principle where the world began. For the person initiated or meditating on the Kalacakra, the process of identification, as in all [[tantric

meditation]], is enacted. The one leading the Kalacakra initiation (the Dalai Lama) becomes Ka/acakra, and with him all the participants become identified with the Kalacakra. All the above are presuppositions that are basic for the actual initiation ritual. There are different layers in the interpretation of a ritual. In

the case of the Kalacakra Tantra there is a complicated philosophical background as to why the ritual is performed inside a purely Buddhist context. The Kalacakra Tantra is regarded as one of the most advanced teachings within Tibetan Buddhism. It is not known or practised in other Buddhist countries, with the

exception of Mongolia. Traditionally, it was an esoteric teaching where the outer forms were well known, but the meditational practice was restricted. Today, the teachings are well known by the Tibetans as well as around the world. However, the more advanced teachings are still not widely known. The importance of the Kalacakra for modem Tibetan Bud3

clhism is clearly shown by the great number of such initiations made by the present Dalai Lama. 4 Another indication of its importance in the dGe-lugs-pa tradition is the threedimensional Kalacakra miil!4ala which

can still be found today in the Potala palace. s A number of non-academic publications on the Kalacakra Tantra meant for practising groups in the western world have been published in later years. Some of them by

Tibetans and others by western practitioners. There is also an interesting site on the Internet, International Kalachakra Network, functioning over the last few years and founded by, among others, David

Reigle. Some valuable material on the Kalacakra has been published on the site. In order to obtain complete access to the site it is necessary to have participated in a Kalacakra initiation and to have a lama

trained in the Kalacakra Tantra as a reference. 6 There is also a website in French maintained by the Kalacakra writer Sofia StrilRever which contains material on the practice of the Kalacakra Tantra. 7 Several

centers for practising the Kalacakra Tantra have been founded in Paris, London, Florence and Graz. 8 Furthe=ore, the Kalacakra Tantra had a certain importance for the Theosophy and H.P.

Blavatsky and her successors. In accordance with the common western image of Tibet as a land of mystery and esoteric teachings, well painted and analysed in the recent works by Donald Lopez and

Martin Brauen/ the founder of Theosophy, H. P. Blavatsky, was interested in the Kalacakra and made some rather confused allusions to it in her works. to From this esoteric tradition also springs

the tradition of Shamballa (with double -11- and unaspirated -b-) as a sort of "paradise" that has had great importance for the esotericism of Alice Bailey!! in the beginning and middle of the last century.

Considering the importance of Bailey for the theories behind the New Age movements, the Kalacakra Tantra can even be said to have some influence on this important movement in Western culture of today. In

the same spirit, the Russian artist Nicholas Roerich undertook a long and awesome joumey through Tibet and Central Asia searching for Shambhala in the 1920s. 12 This journey was certainly of great importance to his son, the tibetological researcher George No 4 The initiations made by the Dalai Lama XIV are as follows: Norbu Lingka, Lhasa, Tibet in May 1954; Norbu Lingka, Lhasa, Tibet in April

1956; Dharamsala, India in March 1970; Bylakuppe, India in May 1971; Bodh Gaya, India in December 1974; Leh in Ladakh, India in September 1976; Madison, USA in June

1981; Dirang in Arunachal Pradesh, India in April 1983; Lahaul and Spiti, India in August 1983; Rikon, Switzerland in July 1985; Bodh Gaya, India in December 1985; Zanskar in

Ladakh, India in July 1988; Los Angeles, USA in July 1989; Sarnath, India in December 1990; New York, USA in October 1991; Kalpa in Himachal Pradesh, India in August

1992; Gangtok in Sikkim, India in April 1993; Jispa in Himachal Pradesh, India in 1994; Barcelona, Spain in December 1994; Mundgod, India in January 1995; Ulan Bator, Mongolia in August 1995; Tabo in Himachal Pradesh, India in June 1996; Sydney, Australia in September 1996; Salugara in West Bengal, India in December 1996; Bloomington,

USA in July 1999; Graz, Austria in July 2002; Bodh Gaya, India January 2003; Toronto, Canada in April 2004. This information can be found, among other places, on the

Internet site of the Tibetan Government in Exile. See also Dalai Lama. 1997:97 and Hammar. 1992:204. 5 Batchelor. 1987: 108-109; Tibet Handbok. 1999:102-103. Also my own observations and documentation from a

visit to the Potala in the summer of 200 1. 6 See International Kalachakra Network: www.kalachakranet.org 7 See www.buddhaline.net 8 Stril-Rever. 2002:247-252. 9 Lopez, Jr. 1998 and Brauen. 2000. 10 For

Blavatsky and Tibet see Brauen 2000:36-41. II See for example the index of her Esoteric Astrology (1951). 12 See Roerich, Nicholas. 1985 (1930); Roerich, N. 1928; Roerich,George. 1931.

Roerich, who also participated in the journey. Nicholas Roerich was inspired by theosophy in his search for Shambhala. There exists a museurn of his art in New York where works inspired by this journey can be seen. 1.2. METHODS AND AIMS.

This dissertation has several aims. At the beginning of the project was the idea of presenting a history of the Kalacakra Tantra from the text "A history of the Kalacakra" by Buston, using other texts to clarify the early history of the Kalacakra in Tibet. Bu-ston lived in the fourteenth century and he wrote the first known doctrinal history of the Kalacakra. My aim is also to investigate the problem of when the

Kalacakra was introduced to Tibet. Furthermore I want to compare the concept of the inner and outer war in the context of the kingdom of Shambhala. The second part of the dissertation is the

doctrinal analysis of one of the main themes in these texts, namely the concept of A.dibuddha, which can be compared to the concepts of the fourth body of the Buddha and the-

concept of paramiik~ara-sukha, the supreme unchanging bliss. The basic method used in this dissertation is to present, translate and analyse texts. I have done some field research, being

present at Kalacakra initiations, but the main work is textual analysis. In the historical part, I have made a translation of Bu-ston' s text in its entirety and then commented upon it. In the doctrinal

chapters, some parts of the Kalacakra texts are presented with the intention of researching for concepts that are of interest to analyse. This method has its limitations and one could

say that it would be better to translate whole chapters of the texts instead. I am aware of this problem, but chose to do this analysis because of the secondary benefit of being able to grasp greater parts of the

Kalacakra texts. In order to find information on the Adi buddha, it is necessary to search the texts for the concept, something that can not be done if attention is ouly paid to one part of the entire texts.

1.3. A SHORT SURVEY OF EARLIER RESEARCH ON THE KALACAKRA TANTRA. The best survey of research on the Kalacakra has been done by John Newman l3 and there is no reason to repeat everything that he has written, but I have

made a short survey with comments on the most important research. For the two chapters on the A.dibuddha concept and on the fourth body of the Buddha, I have made separate surveys of relevant

research. The study of the tantric system of Kalacakra was first introduced to the western scholarly world by Alexander Csoma de Koros who was also the founding pioneer of Tibetan studies. He was the first to translate a short text on Kalacakra and Adi buddha in

1833. 14 Later, a series of scholars would become interested in these teachings. I will analyse Csoma de Koros' article in a following chapter. In the second half of the 19th century, interest grew quite strong

among Western scholars in the chronological systems of Buddhist and Tibetan culture. When they studied Tibetan methods of calculating time, it was obvious that the Kalacakra Tantra was very

important. Csoma de Koros published one chronological table and Schlagintweit later published another. IS S.C. Das published a chronological table in 1889, Schlagintweit translated one in 1897 and Pelliot then

wrote a lengthy article in 1913 about the chronology of Tibet as did B. Laufer. 16 Other research on chronology in Tibet was done by Stael-Holstein, C. Vogel and D.Schuh. 17 These works on

chronology were important in attempting to define general Buddhist chronology, but did not add much to the understanding of the actual teaching of the Kalacakra Tantra. There was also a beginning of

an analysis of the Adibuddha concept made by Louis de La Vallee Poussin that I will treat below in the chapter on Adibuddha. Waddell

referedbriefly to the Kalacakra in his book on Tibetan religion. He, and others, described the tantric tradition in general and especially the Kalacakra Tantra as the . most degenerated and popular form of

Buddhism that existed. 18 He obviously had not read the texts and the very complicated and sophisticated teachings which make the Kalacakra one of the most advanced teachings of later Buddhism. This poor

appreciation of tantra among researchers of Buddhism has unfortunately continued up to present time until the encounter with the living Tibetan Kalacakra tradition and other tantric traditions imposed a change in attitudes. During the first half of the 20th century, academic interest and work on the Kalacakra Tantra continued at a low level. Eliot Wrote about it briefly in the 1920s, with very little

understanding of its teachings. 19 Lalou wrote a short and correct condensation of what was known on the subject in the 1950s,z° There was also a short article by Bandyopadyaya in 1952 which held that the [[Kalacakra

Tantra]] was created in order to unite Buddhists and Hindus against the invading Muslims. 21 This idea of the Kalacakra has been stressed later by B. Banerjee in his edition of the KCT text and in his later

article on the Kalacakra Tantra. He states with conviction that this tantra was actually created for the purpose of uniting Hindus and Buddhists against the common enemy of the Islamic armies?2 The

greatest name in research on the Kalacakra in the 1950s and 60s was Helmut Hoffmann. He wrote a number of articles on the subject. 23 He was interested in analysing Csoma de Koros. 1833 and 1834. [[Csoma de

Koros]]. 1834:181-198; Schlagintweit. 1863:273-287. \6 Das. 1889:37-84; Schlagintweit. 1897; Pelliot. 1913; Laufer. 1913. t7 Stael-Hoistein. 1935/36; Vogel. 1964 and Schuh. 1973. \8 Waddell. 1972 (1895):131. \9 See Eliot. 1921. 20 Lalou. 1957:48-49. 2\ Bandyopahyaya. 1952. 22 BaneIjee 1985 och 2000. 23 Hoffmann. 1951; 1958; 1961; 1964; 1967; 1969n2; 1973; 1975; 1990. \4

the possible central Asian and Iranianlmanichean influence on the teachings and reached the conclusion that such an influence existed. hl the hte 1950s, he held series of seminars on the Kalacakra texts. Another very important area of study is the very pinnacle of the teachings of Kalacakra: the ~aq.anga-yoga, the yoga of the six limbs as contrasted to the classical yoga of Patandjali of eight limbs. It has been studied by Gunter Gr6nbold in a dissertation and several articles. 24 This is the yoga of the completion stage of the Kalacakra, and the fmal stage of it, the samadhi-stage, will lead to the union of prajna and upaya using the sexual yoga, to the great bliss (mahasukha) and consequently to the state of an Adibuddha. The basic verses of the ~aq.anga-yoga can be found in the Sadhana chapter in the KCT and have been translated by Gr6nbold?S The six limbs are Pratyahara, Dhyana, PralJayama, DharalJa, Anusmrti and Samadhi. This ~aq.anga-yoga also exists in the Guhyasamajatantra, with some differences. 26 The latest contribution to the study of the ~aq.anga-yoga is the work of Sferra where he has made a valuable contribution to the study of this subject.27 The concept and tradition of Shambhala is a subject which has attracted much attention. The idea of a hidden kingdom resembling a kind of paradise has made a strong impression in Tibet and also in Mongolia. This tradition will be treated in more detail in the subchapter on Shambhala and the battle between Raudra Kalkin and the barbarians. The past decade has witnessed something of an explosion of academic studies on Tibet in general. This includes studies on the Kalacakra Tantra, the object of three doctoral dissertations in the USA28 by Andresen, Wallace and Hartzell, and several other articles and publications, notably by the pioneer researcher Gunter Gr6nbold and the first researcher to translate parts of the original Kalacakra texts, JOM Newman. Finally, Giacomella Orofmo, Raniero Gnoli, and Francesco Sferra have made valuable contributions to the research. 29 The research by the above authors will be treated in connection with the relevant chapters. Research on the Kalacakra malJq.aZa has also been done, especially by Martin Brauen and by Y. Imaeda. Brauen has made a model of the malJq.ala with computer assistance and clarified the cosmology ofthe tantra. 30

Gronbold. 1969; 1982; 1983a; 1983b; 1983c; 1983d; 1984; 1996h. KCT IV:116-117 in Banerjee. 1985:169; Gronbold.1966:30-31. 26 Wayman. 1977, especiallyp.163-172. 27 Sferra. 2000. 28 Andresen. 1997, Wallace. 1995 and Hartzell. 1997. 29 See Bibliography for references. 30 Brauen. 1997 and Imaeda. 1987. 24 25

THE KALACAKRA IN CONTEMPORARY CONTEXT. REASONS WHY KALACAKRA IS OR TANTRA TODAY

As mentioned earlier, the present XNth Dalai Lama has been very important for the growing interest in the Kalacakra Tantra by giving the Kalacakra initiation to many thousands. The initiation is actually meant to be an introduction and a permission to practice the meditation techniques andyogas found in the Tantra. It is also meant to give a taste of the result that can be obtained by the practice of these methods. There is a moment of rebirth in the initiation ritual when the initiand visualizes himself as coming out of the womb of Visvamata, the female consort of Kalacakra. The participant comes out purified, now capable of identifying himself with the deity Kalacakra. Consequently, this is a kind of purifying rebirth known from other areas in the study of comparative religions. The symbolic rebirth is of great importance but not as important as in other religions where the rebirth rituals are of more central importance. The initiation also creates a karmic bond between the teacher and the initiand and between the initiands. For example, it is said that the final war of this era will take place between the king of Shambhala and the mlecchas, the evil ones. At the time when the texts were compiled, they were identified with the Muslims who were at the time invading India. Everyone who has received the initiation is going to fight in the last war by the side of the future 25 th kalldn of Shambhala, called Raudracakrin. This is an eschatological perspective which is of great importance for Tibetans participating in the Kalacakra initiations today. During the last thirty years, the Kalacakra initiations have become nationalistic events very important for the Tibetans in exile and also for the Tibetans inside Tibet. Almost all Tibetans in exile have by now received the Kalacakra initiation at least once from the Dalai Lama. Having participated in the Kalacakra initiation gives a feeling of belonging together because of the eschatological context and helps to keep alive the hope of returning to Tibet. In 1985, around 10,000 Tibetans from inside Tibet participated in the initiation at Bodh Gaya, something that must have been important for all Tibetans. Subsequently, Tibetans from inside Tibet have not been allowed to go to India to participate in the initiations, although there were some Tibetans from Tibet at the latest initiation in Bodh Gaya in January 2003. At the initiation in Sarnath in 1990 Tibetans were not allowed to travel from Tibet to participate in the ceremony and no passports were issued. People travelling in spite of this were threatened with fines. The Chinese authorities have clearly understood that these initations are important nationalistic events for the Tibetans. 31 At the Kalacakra initiation in Graz in Austria in October 2002, there were 10,000 participants. It was a great media event, broadcast on the Internet by the Osterreichische Rundfunk. The well-known German film director Werner Herzog made a documentary of the occasion. The event was partly sponsored by the city of Graz, perhaps as a way of promoting the city as the cultural capital of Europe in 2003. 32 This initiation also led to a series of protests from some churches claiming that the Dalai Lama's teaching is bad. In particular, the Kalacakra teaching itself has been criticised. A book has been published in 3\

Hammar 1992:205 from Tibetan Review, 26 (2),1991:6. official Internet site of the Kalacakra initiation in Graz in october 2002. www.kalachakra-graz.at

German with severe criticism of the teaching of Kalacakra both from an ethic and a Christian viewpoint. 33 The reason given by the present Dalai Lama to arrange these mass initiations is that the world is in danger and the initiations help to collect the forces of good and help promote peace in the situation of global crisis that we are witnessing in the world today.34 The Dalai Lama gives a complementary explanation as to why the initiations are given to so many when he explains the different possible ways of receiving the Kalacakra initiation. He recognizes that the Kalacakra meditations and the six-limbed yoga are going to be practised only by a few of the participants: the most advanced participants who have a clear experience of the nature of the ultimate reality as it is explained by the great Mahayana philosophers. The intermediate participants have a correct understanding of this philosophy based on studies and reasons, while the less advanced participants have at least a strong appreciation and understanding of Buddhist philosophy. One can also receive the initiation as a blessing and an appreciation of participation. The intention of the initiation is to plant karmic seeds in the minds of the participants and this requires at least an open mind. It is very interesting to see how the very esoteric Kalacakra initiation has changed from being an advanced initiation for small groups of disciples, who have already studied Buddhist philosophy and other tantric teachings, into a mass ceremony where most of the participants do not know much about tantra and do not intellectually understand the teachings. The number of participants, traditionally, was not more than twenty-five persons. 35 Now there is a new tradition, according to Dalai Lama, to give the initiation to many people because of the critical situation in the world and in order to establish strong karmic connections between the minds of human beings and the Kalacakra. 36 We are also approaching the time when the 25 th king of Shambhala is going to come and when everyone who has received the Kalacakra initiation is going to be reborn and obtain the complete enlightenment through the Kalacakra. The initiations are also presented as "Kalachakra for World Peace" by the Dalai Lama and in the material published in connection with the initiations. 37 How can this peace message be motivated from the Kalacakra texts themselves? It is not easy to discern the peace message because these texts show signs of being written during a time of struggle against enemies of Buddhism, primarily in the form of invading Muslims. The basic theme of a future war against evil forces is very important. All the participants in the initiations are going to fight in the war with the future king of Shambhala after they are reborn. Of course, as I will show later in the subchapter on Shambhala, the real fighting is perhaps to be seen as an inner fight to obtain the great liberation and integrate into Nirvana. In that way, the teachings can be seen as promoting peace in the world. There is also a theory that the mere practise of the Kalacakra teachings has a good effect on the world. The Internet site www.trimondi.de and Trimondi 2003. Victor and Victoria Trimondi are pseudon.yms for Hermann and Mariana R5ttgen. Hermann R5ttgen was politically active and a revolutionary on the left wing in the 1970s and then changed perspecties in the 1980s. See www.trimondi.delbiograph.html. 34 See for example Kalachakra Initiation - Switzerland 1985. 35 Mullin. 1991 :9-12. The present Dalai Lama has written a foreword to this book where he comments on his own initiations. J6 Dalai Lama. 1981 :9. 37 See for example pamphlets from 1981,1985 and 1997 and material from 2003 (WTN News January 14). 33

12

Historically, the first recorded mass initiation of Kalacakra was the one given by the Panchen Lama in Peking in 1932. It was arranged because of the war with Japan in order to try to establish peace. This was actually the first time that the theme of peace was presented in connection with a mass initiation. The Swedish ethnographer Gosta Montell was present at the initiation and he wrote that it was arranged by a Buddhist association in Peking which wanted to do something for peace in China. The initiation was made with a predominantly Mongol participation, the Mongols being adherents of Tibetan Buddhism for many centuries. At this event, the thought of fighting for the perfect land of Shambhala was alive with the Mongols and was also an expression of Mongolian nationalism. 38 This event is a good example of a Kalacakra initiation for promoting peace. It is interesting to see how the very esoteric teaching of Kalacakra has been spread to great numbers of people. Formerly, the Kalacakra initiation was not given to groups of more than twenty-five participants. 39 In modem times there is however, a tradition of giving the initiation to great numbers. This modern tradition probably started with the 9 th Panchen Lama. He gave nine Kalacakra initiations in China between 1928 and 1936. Tens of thousands of Chinese and Mongol Buddhists participated on these occasions. The most important of these initiations was the one held in Peking on October 21-24 in 1932 for some 60.000 participants. It is interesting to note that the initiations of the Panchen Lama had a duration of three days, whereas the initiations by the present Dalai Lama last for eleven or twelve days. The difference must be that there were no preliminary Buddhist teachings and that the monks of the Panchen Lama did not create the ma1Jq.ala of coloured sand, something that takes several days. It seems, though, that there was a ma1Jq.ala made of coloured sand at the Peking initiation. A difference is also that the initiations now given in the West do not presuppose that the participants are very knowledgeable in Buddhism. In China and Mongolia the participants were Buddhists and did not need preliminary teachings in the same way. The Peking initiation was urged by a Buddhist association. It was expressly made for peace in the region. Japan had just started the wars in the area by occupying Manchuria. Present at the occasion was also 1iJ.e secretary of education of the Chinese republican government and the I Cang-skya Khutuktu, the head of the Mongolian Buddhists. This shows the importance of the event. 40 The Panchen Lama held a very appreciated Kalacakra initiation as far south as in Hangzhou in 1934, where the audience was more purely Chinese. These activities of an appreciated Tibetan Buddhist lama in China evokes the memory of the Tibetan lamas going to China in order to teach Buddhism at the time of the Mongol dynasty in the 13 th _14th century. The Kalacakra of 1957 was another occasion where politics were important for the conducting of the initiation ritual. This initiation was partly sponsored by the newly founded Tibetan resistance movement of Chushi Gangdruk. Because of the hard Chinese policy in Kham in eastern Tibet a resistance movement of the Khampas was formed. In an 38

Montell. 1942: 165-173 and Lessing 1942.

3. See Mullin. 1991: 9-12. Dalai Lama has written a foreword to this book where he comments on his own initiations. This information is mostly from Jagou. 2004:117-126, who has written a comprehensive biography of the ninth Panchen Lama. Information also comes from the Swedish ethnographer Giista Montell who was present at this initiation, Montell. 1942: 167, 171 and also· in Lessing. 1942, which was the publication Yung-Ho-Kung in the series from the Ethnographical Museum on the collections of the Sven Hedin expeditions.

attempt to cover up their movements the leaders requested that that Dalai Lama would make a Kiilacakra initiation in Lhasa in 1957. The initiation Was conducted by the Dalai Lama and the Tibetan resistance had an occasion to meet. They also offered a longevity ceremony to the Dalai Lama which was meant to symbolise the enthronement of the Dalai Lama as ruler of the whole of Tibet, including Kham. This was a clear occasion when the Kalacakra initiation was used in a political way.4t One of the latest Kalacakra initiations was held at Bodh Gaya in India on January 1120 in 2003. It was held instead of the initiation cancelled one year earlier when the Dalai Lama fell ill. The Buddhist monks from the All India Monks Federation, composed of ethnic Indians who converted to Buddhism Urged by B.R. Ambedkar in the 1950s, opposed the participation of the Dalai Lama, and also the XVIIth Karmapa, in the planned initiation at Bodh Gaya. The monks guarded the Mahabodhi temple in Bihar. They said that Dalai Lama could face a threat to his life if he participated in the initiation. The reasons given for the opposition are vague, for example, that neither the Dalai Lama nor the Karmapa have publicly condemned the demolition of the Barniyan statues by the Talibans in Afghanistan. The All India Monks Association general secretary Bhadant Anand wrote in a memorandum to the president of India that the Dalai Lama through his questionable acts and pretensions had caused avoidable tension between India and China and that the deportation of the Tibetan leader would be a way of improving Sino-Indian relations. Anand also wrote that the Dalai Lama's stay in India is against the interests of India as he is involved in activities harming the country. In addition to this, Anand also claimed that the Karmapa two years previously had entered the Mahabodhi temple with his shoes on, something that he called an attack on Indian culture. A plausible reason for these attacks is that these Buddhists want to limit the influence of the Tibetans and the Dalai Lama.and that they seek to assert their own control over the Buddhist shrines around Bodh Gaya. A consequence of the threats was that the security measures were increased. 42 Subsequently, a pamphlet distributed by these Buddhists in Bodh Gaya said that the Tibetan government in exile has received large sums from the CIA in a questionable manner. The pamphlet questions the existence of the Tibetan government in India, as it should be against the Indian constitution to have another official government in the country.43 The Kalacakra initiation was directly prepared by the Tibetan government-in-exile led by the Secretary of the Department of Religion and Culture who visited Bodh Gaya a month before the initiation. 44 Security was increased even more after new threats from a group of Chinese insurgents called "Norggen" who operate on the border with Nepal and who are reported as having links with Nepal's Maoist rebels. This group was previously unknown and I do not

41 See www. chushigangdruk.org/historylhistory02.html In other sources this second Kalacakra initiation is said to have taken place in 1956. There is a confusion in some way, because there was probably not a third initiation taking place in these years in Lhasa. 42 The WTN News on December 16 2002. A telegram from the AFP and an article by Irnran Khan of the Indo-Asian News Service on December 16. 43 WTNNews January 3,2003. A telegram from the AFP. 44 WTN News January 4,2003.

have much infonnation on the group. The threats were taken seriously by the Indian authorities and metal detectors were installed at the site of the ceremony.45 On JanuarY 9, 2003, twelve neo-Buddhists started an indefinite fast-unto-death against the Dalai Lama near fueir Mahabodhi sanctuary. They wanted to have the Dalai Lama leave India and expressed that he and the 1i h Karmapa Urgyen Trinley Dorje should be expulsed from India because they had pro-China leanings. The fact that the Dalai Lama is content with autonomy for Tibet is also a proof of his pro-Chinese ideas. The secretary Anand further holds that China threatens to extend its hegemony to the disputed areas near the Indian frontier. They were to continue their fast until the Indian government asked the Dalai Lama and the Karmapa to leave India. 46 The action of the neo-Buddhist monks was intensified on January 11 when some of the fasting monks threatened to immolate themselves if the Dalai Lama did not initiate a dialogue with them within the next twenty-four hours. 47 The monks were taken into custody by the Indian authorities after only one day on a charge of attempting suicide and creating a disturbance, but the fast continued in jail. 48 There is a historical background of the Ambedkar Buddhists trying to "liberate" the Buddhist site of Bodh Gaya, which is still run by a committee dominated by Hindus. They have previously organised hunger strikes and made threats of immolation. There is a clear tradition of militancy among the neo-Buddhists and a history of conflict between the traditional Buddhists of Tibet and other Buddhist countries and the Buddhists of the Ambedkar tradition. Johannes Beltz in his doctoral thesis even claims that these neo-Buddhists have the trait of being fundamentalists in the modern meaning of the word. These militant actions can perhaps be compared to the modern Hindu nationalist movement, for example, the case of the conflict of Ayodhya. 49 There has also existed a certain criticism of the neo Buddhists by the Dalai Lama. He has said that they are criticising the Hindus in too much of a militant fashion. Others have criticised the movement for being more a movement for social refonn than for practising Buddhism.50 In light of this historical situation, the conflict connected with the Kalacakra initiation of Bodh Gaya 2003 is perhaps not so difficult to understand. The Kalacakra initiation was attended by about 200,000 people, mostly Tibetans from India, including Sikkim, and Nepal. Thousands of people from western countries and from the rest of India also attended, in total, people from around fifty countries. There were also some attendees from inside Tibet who apparently had received visas for the occasion. 51 It was an outspoken policy by the Tibetan government in Dharamsala to expose the Tibetan issue in various ways at the occasion of the initiation. They distributed booklets, pamphlets, photographs and showed documentary films. There was a photo exhibition of the Chinese oppression in Tibet and a booklet in Tibetan and English making it clear that WTN News January 6,2003. WTN News January 9, 2003. 41 WTN News JanuaI)' 11, 2003. 48 WTN News JanuaI)' 12, and from the Ambedkar Times, ambedkar times@yahoo.com. The later information was posted in a network for dalit Ambedkar Buddhists and kindly forwarded to me by Dr. Gunnel Cederliif ofUppsa/a University . • 9 Beltz. 2001:194-95. 50 Beltz. 2001:252-53. 51 WTN News JanuaI)' 12, 2003 and December 26,2002. 4S

peace and stability cannot return to Tibet without the Dalai Lama's participation in governance. The standpoint of the Dalai Lama and the Tibetan government-in-exile is that they are not seeking the independance of Tibet, but an opportunity of the Tibetan people for genuine self-rule. 52 These activities are actually done at most Ktilacakra initiations, but were accentuated at this mega-event actually organized by the Tibetan government-inexile. In conclusion, the Ktilacakra initiations clearly are of great importance for the Tibetan national identity, as the Tibetans are assembled in an important ceremony led by the Dalai Lama, which also gives hope of better times to come. The event has an eschatological meaning with the coming war of the king of Shambhala for the sake of Buddhism and the forces of good in general. This feeling can, of course, be transposed to the situation in Tibet and the wish to see a free Tibet, or at least a real self-governing Tibet, to which the refugees can return. As has been summarized by Yeshi Choedon, the Chinese leaders' policy on religion after 1994 has become harder, with more suppression and restriction of religious activities, as religion posed a major challenge to state authority. As the Tibetans had no real access to power, religion has become more and more important for the national identity and much energy and emotion has been devoted to a religious revival and reconstruction. Buddhism is an alternative to the ideology ofthe Chinese state and the religious revival has become a challenge to Chinese rule. Almost every form of Tibetan religious and cultural activity is of political importance and therefore there has been a considerable effort to restrict the growth of religion in Tibet. 53 There has consequently been a campaign against the Dalai Lama and the strategy has been to eliminate both his religious and political influences from the region. Consequently, the Ktilacakra initiations by the Dalai Lama are events of great importance for the Tibetans and thorough studies of this Tantric system of teachings are also motivated from a contemporary view-point.

52 53

WTN News January 11, 2003; Articles from Rediff.com and Indo-Asian News Service. Choedon. 2002:381.

THE EARLY STORY OF KALACAKRA IN TIBET

The actual year when the Kalacakra was introduced into India is a question that has been discussed by many scholars since western research started. A short survey of this issue will be made in this chapter. An investigation then follows into a text that treats the first introducers of Kalacakra to Tibet. The main part of this chapter then follows, treating a text by Bu-ston from 1329 outlining the history of Kalacalmi from the introduction up to the 14th century. An annotated translation of that text will be presented.

THE ORIGIN OF KALACAKRA IN SHAMBALA54 AND INDIA

The Kalacakra Tantra was, according to its own tradition, preached by Siikyamuni Buddha at the Dhiinyakaraka stupa in Andhra Pradesh at the request of king Sucandra of Shambhala. The Dhiinyaka{aka stupa was later called Amariivatl and has existed since the Siitaviihana dynasty in the present Andhra Pradesh. The dynasty existed from some decades B.C. until the third century A.D. 55 The Kalacakra Tantra did not spread with early Buddhism, but was directly brought to Sucandra's country Shambhala. There, the teachings were developed and commented upon during more than 1000 years. In the 10th century, it made its appearance in India and then contained statements about Jesus and Muhammed and many other things that had taken place long after the life of Buddha. The explanation given by the texts is that facts about, for example, Islam were told in the form of prophecies by Siikyamuni Buddha. It is not possible to judge these statements with absolute certainty, but without making reference to supernatural ideas, one can only draw the conclusion that the Kalacakra texts were written at the earliest a couple of centuries after Muhammed's life-time. Consequently, it is possible to say something about Kalacakra in Shambhala only by making reference to the Kalacakra texts themselves. 56 There exists some other interesting texts in this context, especially the Kaliipiivatiira,57 which has survived in Tibetan translation. Sofia Stril-Rever recently made an interesting contribution by treating the traditional Tibetan view on Shambhala. 58 '4 In the Sanskrit texts the well-known Tibetan subject of "Shambhala" is spelled "Sambhala". Consequently the original spelling of the concept should be "Sambhala". I will mainly use the word Shambhala as it is the best known concept in Tibetan Buddhism. 55 Tripathi. 1977 (1942):191-198, 444; Dutt. 1988 (1962):135-136; Subrahmanyam. 2001 :8. For an excellent discussion oflhe problem of the location and tradition concerning the Dhiinyakataka stupa see Macdonald. 1970. 56 KCT I: 150-170. In the. Vimalaprabhii there are pieces of information in many places. 57 P. 5908. Toh.4464. The text has been translated and commented upon by Bernbaum (Bernbaum. 1985: 42-81). There exists other guidebooks to Shambhala by Tibetan authors. The most famous being the one by the sixth Panchen Lama entitled Shambhala 'i lam-yig. This work was one of the first texts treating subjects in the Kalacakra Tanlra that was translated into a western language (GrtinwedeL 1915). although the translation leaves much to be desired. ,. Stril-Rever. 2000:49-57, 96 note 7.

The history of Kalacakra in India is more complicated and has been treated first by Helmut Hoffmann andAriane Macdonald and then by John Newman and G. Orofino. 59 The most recent contributions are the dissertations by Jensine Andresen60 and James Hartzell. 61 2.2. THE INTRODUCTION AND DEVELOPMENT OF KALACAKRA IN TIBET.

This subchapter contains two sections. The first part treats the question concerning the dates of the introduction of Kalacakra to Tibet on the basis of a text by Nyang Ral-pa-can which contains the first known mention of Gyi-jo and 'Bro Lo-tsa-ba who were the first to translate the Kalacakra texts to Tibetan. The second part deals with the text Dus- 'khor chos- 'byung by Bu-ston which is the first known history of Kalacakra. A summary and analysis of the text is presented first, followed by an annotated translation. 2.2.1. On the dates of the introduction of Kalacakra to Tibet. This chapter treats the History of Kalacakra in Tibet up to the time of Bu-ston Rin-chengrub (1290-1364), who wrote the first known extant history of Kalacakra. 62 Bu-ston 's text called rGyud-sde'i zab-don sgo-'byed rin-chen gces-pa'i Ide-mig, [short title:] Dus-'khor chos- 'byung written in 1329 will be presented first. The text consists of 46 Tibetan folios, which corresponds to p.1-92 in the Indian edition by Lokesh Chandra. The reason for studying this text is evident considering that it is the most ancient known extant history of Kalacakra. The text is a copy of a block-print edition of his works made in Lhasa in 1921. It was prepared for the 13th Dalai Lama between 1917 and 1919 and printed at the Zholpar-khang printing house in Lhasa. 63 The works of Bu-ston were collected before the 17th century and existed in one edition in his home monastery Zha-lu and one in Lhasa. The Lhasa edition is now the only version available. 64 The original of the published edition is kept in New DeJhi. The colophon states that the composition of the Dus- 'khor chos- 'byung was urged by Bu-ston's teacher and that it contains both the Rva and the 'Bro traditions of Kalacakra. Bu-ston's commentaries follow the laghutantra Srf-Kalacakra-tantra-riija, the Vimalaprabhii commentary and also, as far as possible, the lost mulatantra. As in most of his writings, Bu-ston organizes and classifies the material in a systematic way. In The History of the Monastery of Zhwa-lu, there is the information that Bu-ston actually taught from his Dus- 'khor chos- 'byung. 65

"Hoffmann. 1964,1967, 1975; Newman. 1985, 1987a; Orofino. 1994 and 1995; Macdonald. 1970. 6. Andresen. 1997, Wallace. 1995, Hartzell. 1997 and Newman. 1998a and 1998b. 61 Hartzell. 1997:969-1056. 62 Bu-ston. 1965d:56-74. 63 Ruegg. 1966:41. 6. Chandra. 1965:1-4. 65 The History ofthe Monastery ofZhwa-lu, p.81;line 6 andp.82, line I.

The text Dus- 'khor chos- 'byung begins with salutations to Kalacakra, the Buddha, the Kalacakra texts and so forth, and the text is divided into four chapters. Then it continues to explain the development of the cosmos and enumerates the Buddhas that will appear in the different kalpas. The hi'story is related of the life of sakyamuni and of how the Kalacakra Tantra was preached by the Buddha at the Dhanyakaraka stupa in present Andhra Pradesh, Then follows how the texts were guarded by the kings of Shambhala and the lineage of these kings. On page 56 (fo1.27a) in the Indian edition the explanation of how the Kalacakra Tantra was brought to India begins. This part (p.56-61) has been translated by George Roerich in the meaning that he has translated mKhas-grub-rje's text on this matter, which in turn was copied almost word by word from the text by Bu-ston, written one hundred years earlier than mKhas-grub-rje's (in 1434).66 This has also been remarked upon by John Newman in his very interesting article on the history of Kalacakra. He makes a new translation of the text, directly from Bu_ston. 67 A final translation of this text has been made in Newman's dissertation, where he includes more details on the history of Kalacakra in India. 68 A summary of this part of the text (p.56-61) follows: 69 The text (p.56) starts with telling the story of the Rva tradition of Kalacakra. The Indian Cilu is mentioned first. His disciple was PilJcJo who taught the whole Bodhisattva Corpus, which is comprised by the Kalacakra Tantra, its commentaries and two texts from the Hevajra and Cakrasa1!lvara tantric systems. After PilJcJo came Kalacakrapiida, the Elder and then Kalacakrapada, the Younger. Somaniitha received the Kalacakra from both Kalacakrapada the Elder and the Younger. He probably visited Tibet around the year 1064.1° Newman identifies Kalacakrapada, the ElderwithPilJcJo and Kalacakrapiida, the Younger with Naropa. 71 The Rva, 'Bro, and Gyijo zla-ba'i 'od-zer schools of Kalacakra have, according to Newman, their origin in Naropa. Consequently, the introduction of Kalacakra to India probably took place in the early part of the 11 th century. There is a date, 1012 A.D., mentioned in both the laghutantra and the Vimalaprabha which means that these texts were not written earlier. 72 John Newman has recently written a comprehensive article on the dating of the Kalacakra texts. He reaches the conclusion that the mleccha year 403 after Hijra73 corresponds to 1924/25 or 1026/27. He also states that the mention of this date in the Kalacakra means that the texts could not have been written until after the beginning of the sexagenary cycle, which began in 1025 or 1027. His general conclusion is that the Srf-Kalacakra-tantra-riija and

"Roerich.1932:18-22. 67 Newman. 1985:66-71; Newman. 1987a:76-89. 6' Newman. 1987a:70-114. 69 Bu-ston. 1965a:56-61; Newman. 1987a:76-89, 70 For example see Bod rgya tshig mdzod chen mo. 1985:3216 and Newman. 1987a:92, note 13. 71 Newman. 1987a:l06. 72 Newman. 1987a:85, note 13. For a more elaborate discussion on the dating of the texts see Newman. 1998 •. 73 The MuslimlMleccha chronology, beginning with year of Hijra when Muhammed left from Mecka to Medina in the year 622 AD.

the Vimalaprabha were completed between 1025 'and 1040 A.D. which seems to be a realistic dating?4 The most common dating of Niiropa is set by Wylie to 956-1040. 75 This datiTIg is not very certain. The foregoing means that the Kalacakra hardly could have been introduced to Tibet as early as the traditional date of 1027. Ariane Macdonald has argued for a later dating for the introduction of Kalacakra to Tibet. She places the date for the introduction to the last 25 years of the 11 th century, after Atisa, whom she considered played no role in this introduction. 76 If we consider the early mention of the introduction of Kalacakra to Tibet by Nyi-ma 'od-zer, which I will treat in detail later, it seems more probable that the main tradition was introduced by Gyi-jo before 1040. The fIrst mention of the introducers of Kalacakra to Tibet that I have found is in the rNying-ma'i chos- 'byung chen-mo by Nyang Ral-pa-can Nyi-ma 'od-zer( 1136-1204). 77 The author Nyang Ral-pa-can married a daughter of Dharmesvara called 'Jo- 'bum-ma and he begot with her the sons Nam-mkha' 'od-zer and Nam-mkha-dpal. 78 This is a very interesting fact because it shows that Nyang-Ral was directly involved in the 'Bro tradition of Kalacakra. DharmeSvara and his nephew are known as two of the main tradition holders in the 'Bro school in the 12th century.79 Furthermore, DharmeSvara was the main tradition holder after Yu-mo in the controversial Jo-nang-pa school. This school, and its main master Dol-po-pa (14th century), is mainly known for its gZhan-stong theory of "substantialism" which is partly founded on an interpretation of Kalacakra. Taken together, Nyang-Ral must have been quite familiar with the Kalacakra and naturally treated only the 'Bro school in his chos- 'byung, not the Rva school. Consequently, the question arises whether Nyang-Ral had any signifIcant part in the promotionof the tradition of Kalacakra. Another known fact about Nyang-Ral is that he was an important gter-ston (discoverer of texts) inside the rNying-ma-pa school and one of the great names of this school. It would be an interesting issue to investigate the relation of the rNying-ma tradition with the Kalacakra. 2.2. 1. a. Thefirst mention ofthe translators of the Kalacakra Tantra.

The Tibetan text of Nyang Ral-pa-can Nyi-ma 'od-zer and the English translation are presented: I. The mention of Gyi-jo zla-ba'i 'od-zer: Tibetan text:

Newman. 1998a:342-343. Wylie. 1982:687-692. 76 Macdonald. 1970:175-176. 77 Meisezahl. 1985:TafeI341.1.l (fo1.509a) and Tafel 349.3.1 (foI.523a). Stein. 1981:50 gives the dates of Nyang Ral pa can as 1124-1192. 78 Dargyay. 1977:214, note 56 and 97-103. Dargyay is here quoting his biography Yid-bzhin norbu'iphrengba (fol. la. Dargyay prefers the dating 1124-1192. 79 Bu-ston. 1965d:61-65 and Roerich. 1949/53:755,768. 74

(Tafel 341.1.1., fo1.509a) llta bla-ma'i sku-che'i smad-la spu-rang-pa zhang-chung 1 btsun-gsar shes-rab-la bka' bgos-nas 1 yul-dbus-kyi pa1J4i-ta shri bajra-bho-dhi dang 110tstsha-ba ftJIi-cho zla-ba 'od-zer gyis dus- 'khor dang 1 ma-rgyud 'ga' bsgyur-ro 1 mnga 'ris stod-du lo-gsum gzltug$ 1 Translation: In the later part of the lifetime of IHa bla-ma , after having instructed sPu-rang-pa Zhangchung bTsun-gsar Shes-rab, Pa1J4i-ta Shri Bajra-bho-dhi of Miidhyadesa [[[India]]] and 10tstsha-ba Gyi-cho Zla-ba 'od-zer translated the Kalacakra and some mother tantras. [They] stayed in upper mNga '-ris for three years.

ll. The mention of 'Bro lo-tsa-ba Shes-rab-grags. Tibetan text: (Tafel 349.3.1., fo1.523a) 'brom lo-tstsha-ba shes-rab-grags kyis kha-che zla-mgon spyandrangs-pa nas / dus- 'khor 'grel-pa che-chung sngags dang bcas-pa bsgyur-ro 1 de-nas 'jam-dpal zab-don la-sogs-pa bsgyur-ro 1 Translation: After having invited Kha-che Zla-mgon [Somaniitha], 'Brom Lo-tsa-ba Shes-rab-grags translated the Great and Small Kalacakra Commentary together with [other] tantras. After that [they] translated the 'Jam-dpal zab-don [The deep sense of MiiiijusrlJ. The first text mentions the founder of the Gyi-jo school of Kalacakra which, according to Bu-ston, is the third important school of this tantric system in Tibet. 8o Gyi-jo Zla-ba'i 'odzer is in this text called Gyi-cho, but probably this is only a misspelling without any greater significance. It is a place name and both spellings are represented in catalogues of the Tibetan canon. 81 Bhadrabodhi is also called Bajra-bo-dhi,which probably does not have any great significance, keeping in mind the similarity of the two words Bhadra and Bajra (vajra). The word is the same as Bodhibhadra mentioned later in the text. Further, lHa bla-ma is, according to 'Gos lo-tsa-ba gZhon-nu-dpal, the same as the renowned king 'Khor-re, later a monk under the name lHa bla-ma Ye-shes- 'od, who was involved in the invitation of Atisa (982-1054) to Tibet. 82 Later he has been identified as the brother Srong-nge. 83 There is a problem here because the nephew of Ye-shes- 'od, B/ang-chub- ~od is also known by the name lHa bla-ma according to Sum-pa mkhan-po.8 Further, according to Tucci, Byang-chub- 'od was given the title lHa bla-ma, that is to say that he was the spiritual heir of Ye-shes- 'od. 8S However 'Gos Lo-tsa-ba gives Byang-chub- 'od the title lHa btsun pa, lHa-btsun and also lHa yi sras and reserves lHa bla-ma only for Ye-shes- 'od. 86 Bu-ston. 1965d:74. Lalou. 1933:224 and Cordier. 1909:19 "Lo-ca-ba Zla-bal;zi I;zod-zer [[[Candraprabha]]] de Gyi-co". 82 Roerich. 1949/53:244. 83 Kannay. 1980:150. 84 Sum-pa mkhan-po. 1908 (1748) as quoted in Stein. 1981:48. 85 Tucci. 1933:24 and Naudou. 1968:159. 86 Roerich. 1949153:86, 244. 80

Considering that Atisa is said to have been invited by Byang chub- 'ad in the year 1042 it is probable that IHa bla-rna Ye-shes- 'ad is refered to. Most important in this context is that Nyang Ral-pa-can at other places in the same text reserves the title Lha bla-rn~ for Yeshes- 'ad, while Byang-chub- 'ad is mentioned as IHa Byang-chub- 'ad. 87 Consequently, supposing that Bhadrabodhi and Gyi-jo translated the Kalacakra in the later lifetime of IHa bla-rna Ye-shes- 'od, the time would be before Atisa came to Tibet in 1042 88 on an invitation from Byang-chub- 'od. 89 The well-known story related in The Blue Annals is that Ye-shes- 'ad waged a war against the Garloq in order to obtain enough gold to invite Atisa to Tibet. He was captured and made prisoner, and then his nephew, the monk Byang-chub- 'ad, raised enough gold to buy him free from the Gar/oq. Byang-chub'ad visited Ye-shes- 'od and he said that the gold should be used for inviting Atisa instead of liberating himself as he was an old man. In that case, Ye-shes- 'ad should have died in prison, some time after approximately 1040 and so sacrified himself for the sake of inviting Atisa to Tibet. It is not completely clear from these sources exactly when or where he died. 90 This story is historically very uncertain. It could have been an amendment in later historical texts. 'Gas lo-tsa-ba clearly states that it was Ye-shes- 'ad who received Atisa when he came to rnNga'-ris and later to dBus. 91 As Bhadrabodhi and Gyi-jo are said to have arrived in the later lifetime of IHa-bla-rna, that should mean that Ye-shes- 'ad was still active in the kingdom, although he had already abdicated the throne much earlier. It should be remembered that Rin-chen bzang-po, who was sent to India by Ye-shes- 'ad, came back to Tibet in 978, so the former king must have been very old around 1040. Rin-chen bzang-po was about 85 when Atisa came to Tibet and Ye-shes- 'ad was the king that had sent him to India, which supposes that he must have been more than 100 years old.92 It is not very probable that Nyi-rna 'od-zer would have written that Gyi-jo and Bhadrabodhi came to Tibet and translated the Kalacakra in the later life-time of IHa bla-rna if Ye-shes- 'ad was imprisoned by the Garloq at that time. More probable is that they came when Ye-shes- 'ad was still responsible for the warfare, that is, at the latest in 1040 when Atisa was already on his way to Tibet, invited with the money supposed to be assembled by Byang-chub- 'ad for the liberation of Ye-shes- 'ad. 'Gas lo-tsa-ba is here using the title Lha bla-rna for the king who invited Atisa. Ye-shes- 'ad was at the time supposedly in prison and could not receive anyone. Still, in other places in his text, 'Gas lo-tsa-ba reserves the title Lha-bla-rna for Yeshes '- 'ad and gives Byang-chub- 'ad the. name Lha-tsun-pa. 93 Quite contrary to the inner logic of both Nyang-Ral's and 'Gas lo-tsa-ba's texts, it must be supposed that they were Meisezahl. 1985: Tafel 332.2.6 and 337.3.3. AtiSa is said to have been in Tibet between 1042 and 1056 (Snellgrove. 1987:477) 89 Other texts translated together with Bhadrabodhi are Toh.4528 (a Kalacakra text) and Toh.4476 - Srl Kalacakra-laghutantrariija-hrdaya; interestingly enough revised by Samantairl and Chos-rab. In the colophon ofToh.4528 is mentioned that the translation was urged by the Yon-bdag Zhang-btsun tfge-long, which could be a reference to the Zhang-chung btsun-gsar shes-rab mentioned above in the text by Nyangral-pa-can. See also Toh.ll97 on Sampu!a-tantra. 90 Shakabpa. 1984 (1967):56-58; Roerich. 1949/53:244-250; Eimer. 1979:1. Teil: 215-218, 2. Teil:149-155; Eimer. 1974:21 note 13; Chattopadhyaya. 1967:283-290. 91 Roerich. 1949/53:247-248. 92 Karmay. 1980:158-159, note 26. 93 Roerich. 1949/53:244. B7

writing about Byang-chub- 'od instead of Ye-shes- 'od. Taken together, this seems to signify that Gyi-jo came to Tibet some years before 1040, not very far from the traditional date of 1027. These questions on dating bring us to later research on the dating of Ye-shes- 'od presented by Samten G. Karmay in 1979. He has in his article "The ordinance of Lha-bla-ma Ye-shes- 'od' used a biography on Rin-chen-bzang-po that throws some light on this problem. 94 From this biography, it can be concluded, according to Karmay, that Ye-shes- 'od . died at the end of the 10th century or the beginning of the 11th century.95 If we follow the earlier traditional dating of Ye-shes- 'od, it follows that he died in captivity some time in the 1030s and Bhadrabodhi and Gyi-jo should have introduced and translated the Kalacakra texts in Tibet previous to tbis time, as it should have happened during the life-time of Yeshes- 'od. With the new and probably more relevant dating of the king, the problem arises again how it could be said in Nyang-Ral's text that the two translators were active during the life-time of Ye-shes- 'od. It seems quite improbable that they could have done the translation work as early as around the year 1000, as there is a date in the Kalacakra texts that can as interpreted as 1024/25 or 1026/27 and the text could not have been completed prior to this. 96 The translation into Tibetan must have occured later. The story about Ye-shes- 'od could also be a legend or relate to something else. ill this context, it can be noted that Buston in his Chos- 'byung does not mention all these events but only says that Atisa was invited by Byang-chub- 'od. 97 The only possibility that remains is that 'Gos lo-tsa-ba and Nyang Ral-pa-can when they mention IHa-bla-ma as inviting Atisa and the translators Bhadrabodhi and Gyi-jo actually mean Byang-chub- 'od instead of Ye-shes- 'od, as the inner logic in the texts demands. In conclusion, the final solution of the problem is still not solved as exact dates for Byang-chub- 'od are also missing. The probable date for the introduction still appears to be around 1030/1040 A.D. Nyang-Ral's text could also imply a new dating of Gyi-jo, Bhadrabodhi and the introduction of Kalacakra to Tibet at the end of the 10th or the beginning of the 11th century. There exists new information concerning Ye-shes- 'od from Laxman Thakur where he has reached the conclusion that Ye-shes- 'od passed through Ta-pho in Spiti in the year 1004. 98 Jolm Newman has in his dissertation the presently most reliable analysis of the dates of Gyi-jo. He places Gyi-jo in the first half of the 11th century and regards him as almost certainly the first Tibetan to translate texts on the Kalacakra, which is confirmed by the texts cited here. 99 What can be added from this dissertation is that Gyi -jo and Bhadrabodhi probably came to Tibet before 1040. Of interest in tbis connection is that Bhadrabodhi is cited as the teacher of Atisa. If it is the same person, it means that the connection Atisa and Kialacakra is not totally impossible because Bhadrabodhi was a renowned ,. Kannay. 1980:150-162; Rin-chen-bzang-po. 1977:51-128; Snellgrove. 1987:480 and Snellgrove & Skorupski. 1980:92. "Kannay. 1980:158-159 note 26. % Newman. 1987a:538-539; Newman. 1987b:100; Newman. 1998a; Schuh. 1973:120-122. Also interesting is: Snellgrove 1987:480 and Snellgrove and Skorupski 1980:92. "Bu-ston. 1964 (1932):212-214 . .. Thakur. 1995:972 and Thakur. 2001:24,43,80,148. Thakur. 2001 is a thorough investigation of the monastery ofTabo in Spiti, Himachal Pradesh. Newman. 1987a:102-106.

Kalacakra scholar. Another interesting fact is that Gyi-jo also made translations under Atiia.100 . There is a problem with the dating of Gyi-jo, because it is told in the Blue Annals that Gyi-jo invited the fudianpa~4ita Gayiidhara to mNga'_ris. 101 It was Gayiidhara who gave the Lam- 'bras-doctrines to 'Brog-mi (992-1072),102 who paid 500 golden srang 103 for that teaching with a promise of exclusiveness for Tibet. When Gyi-jo invited Gayiidhara, 'Brog-mi had just died. Consequently, this event should have taken place soon after the year 1072, which means that Gyi-jo was active rather late in the 11 th century. It can be found in the bsTan- 'gyur that he cooperated with Gayiidhara on translations of Hevajra texts. 104 The fact that Gyi-jo was active so late in the 11th century indicates that his translation work with Bhadrabodhi could not have taken place around the year 1000 when Yeshes- 'od, according to Karmay, died. It is interesting in this context to note that Bhadrabodhi is mentioned as the teacher of Atiia, which means that the Kalacakra was well known by Atiia, but that he chose not to teach this doctrine himself in Tibet. Accordingly, he must have been well aware of the activities by Bhadrabodhi in spreading the teachings in Tibet. It is not possible to place Bhadrabodhis arrival and activities in Tibet too late in time. Atiia (982-1054) arrived in Tibet at the age of 60 in the year 1042. Bhadrabodhi must have been considerably older, being his teacher, and consequently he probably already was present whenAtiia came to Tibet. As for the dating of Byang-chub- 'od, it is evident from many sources that it was he who received Atiia and supported him, which means that he was active during the years around 1030s to 1050s.105 Still, I am not convinced that in the text by Nyang-ral, Lha-blama stands for Byang-chub-'od and the question therefore is not completely resolved. fu the text, Lha-bla-ma should be a title for Ye-shes- 'od. fu support for this, Byang-chub- 'od should be named IHa-bla-ma. It is the conclusion of G.Tucci that he received this title. 106 The next problem in the text rNying-ma'i chos- 'byung is the statement that Bhadrabodhi and Gyi-jo first taught the Kiilacalcra to sPu-rang-pa zhang-chung bTsun-gsar shes-rab and then translated the Dus- 'khor. fu this context, it is probable that Dus- 'khor, which is Tibetan/or Kalacakra, is referring to the Kalacakra texts in general, not to any particular Kiilacakra text. Who then was sPu-rang-pa Zhang-chung bTsun-gsar Shesrab?107 sOne should note that sPu-rang-pa is a word for "the man from sPu-rang," that is from sPu-rang near lake Manasarowar on the pilgrim road to Mount Kailai. Zhang-chung is the younger maternal uncle and bTsun-gsar shes-rab could be the personal name. Another possibility is that it is another name for IHa-bla-ma, but I have not found that name in the literature.IHa-bla-ma Ye-shes- 'odthough, is called "King of Pu-hrangs,,108 and he posToh.4748-4760. A series of small texts on Hevajra translated together with Dipaf!!kiirairyniina (Atiia). ,o'Roerich. 1949153:207; Deb ther ngon po. 1976. Vol. Nga fo1.2a. 'O'Snellgrove. 1987:488 for the dating of 'Brog-mi. ,03 I srang is 100 zho. The ancient currency in Tibet. " 104 Lalou. 1933:143 and Cordier. 1908:84. He translated the following texts together with Gayiidhara: Toh.378-379 (Sa/'flvara), 424,1272 and 1298 (Hevajra), 1356 and 1366 (Kiilacakra), 1417, 1652, 1655-57, 4604,4849-50,4853-54. 'os Roerich. 1949/53:37,244,305 and 374. Bu-ston. 1964 (1932):213. ,06 Tucci. 1933:24; Naudou. 1968:159 and 213. '07 For the words sPu and sPu-rang see Haarh. 1969:227-230. 108 Kannay. 1979:153. 100

sibly also governed Zhang-zhung, but the inner logic of the text makes that interpretation less probable. However, it seems that Bhadrabhodhi and Gyi-jo travelled this way to arrive at the kingdom of Guge further west, as it is said in the text that they stayed for three years in "upper" (stod) mNga '-ris, which should mean the region of Guge. Finally, it is st~ted in the text that they translated the Kalacakra and some mother tantras which probably means that they translated the laghutantra itself. 'Gos lo-tsa-ba also states that Gyi-jo translated this text and consequently this possibly was the first Tibetan translation. The canonical translation by Somanatha and 'Bro Shes-rab-grags has to be of a considerably later date, but it should also be noted that this text, according to both Bu-ston and 'Gas lo-tsa-ba, was translated many times by different scholars. 109 It has been said that the Kalacakra text has been translated to Tibetan more times than any other Buddhist text. It is also said that Gyi-jo and Bhadrabodhi translated the small Kalacakra text mentioned below and another commentary on the Kalacakra. 110 Furthermore it is stated in this text by Nyang Ral-pa-can that Gyijo and Bhadrabadhi translated some ma-rgyud (mother tantras) without defining titles. There are two more translations in the Tibetan canon by these two, and they are both short texts on the Kalacakra. 111 In spite of the complications concerning the dating of Gyi-jo and Bhadrabodhi as presented here, the most probable dating of the introduction of the Kalacakra to Tibet is around 1030 to 1040 A.D. As will be shown in the following chapter, Somanatha and 'Bro lo-tsa-ba must have been active considerably later, although there is a small possibility that Somanatha arrived in Tibet considerably earlier. Another complication with these dates comes from a reading of the colophon to the small Kanjur text Srf Kalacakra-garbha~nama-tantra Toh.364. 112 This colophon mentions that the text was translated by Srf Bhadrabodhi and Gyi-jo zla-ba'i 'od-zer on the request of 'Bro dGe-slong. Supposedly, this means that it was the same 'Bro lo-tsa-ba as the one mentioned below and it also implies a direct connection between these three masters. Because 'Bro requested the translation, it means that he already had some position within the community of masters working with the Kalacakra texts. This is contradictory in respect to the accepted fact that Bhadrabodhi and Gyi-jo were the first who translated Kalacakra texts. Probably they were the first, but 'Bro lo-tsa-ba was already in the 1030s active in the transport of these texts to Tibet. The traditional date for the arrival of Somanatha to Tibet and the consequent cooperation of the two in translating the basic texts of Kalacakra is 1064 and it is difficult to understand how 'Bro was already working with the other Kalacakra translators over thirty years prior to this date. Perhaps it is necessary to pre-date both. An Indian master was invited to Tibet by the king Ye-ses- 'od before Atisa (1042) with the name Subhatisrfsanti. He revised a translation of the text Hevajrapil:u!arthatfkii (Toh.1180) made by Maitri-pa and ('Bro) Ses-rab-grags-pa. This implies an earlier activ-

Roerich. 1949/53:837 and Bu-ston.1965d:74. Toh.l365, Srf-Kiilacakra-garbhalamkara-siidhana-nama, 111 Toh. 4476, 4528. 112 Toh.364, In the Nyingma edition. 1982, Val.28, p.73:288, line 6-7. The text has 2 fols. (4 pages 285-288). Newman has noted the existence of this colophon (Newman. 1987a: 99, note 66). 109 110

25

ity as a translator for 'Bro. I 13 An interesting detail in this connection is that 'Bro was involved in translating one of three texts comprising the so called Bodhisattva corpus. The connection between the three texts is again emphasized. 114 • Another question that arises is why 'Bro wanted another translation of the texts when he was already involved in the first translation of Kiilacakra texts. The answer to that question could be that 'Bro, here presented as 'Bro dge-slong, was not yet active as a translator and therefore urged that translations be made by Bodhibhadra and Gyi-jo. Later, when he himself became a translator and had received the title of translator (lo-tsa-ba), he wanted to improve on the earlier translation and invited Somaniitha to Tibet. Still, it is not quite clear why 'Bro is mentioned in this colophon. The second part of the text by Nyang Ral-pa-can mentions 'Bro(m) lo-tsa-ba Shesrab-grags as the one who invited Somaniitha and translated the Kiilacakra texts together with him. The text says that they translated the Great and Small Kiilacakra Commentary. Usually the Great Commentary is a name for the main commentary Vimalaprabhii, but it is more difficult to understand what is meant by the small commentary. Furthermore, it is somewhat awkward that only the commentaries and not the basic text (the laghutantra) are mentioned. Finally, it is mentioned that they translated the 'Jam-dpal zab-don (the profound sense of Mafzjusrl ). This could possibly be the text Mafzjusrl-niima-sanglti which has a direct connection to Kiilacakra, but they are not the canonical translators of this text. I 15

Concerning the early history of Kalacakra in Tibet. An introduction to and analysis of Bu-ston's "A History of Kalacakra"

This chapter treats the doctrinal history of Kiilacakra in Tibet from its introduction in the first half of the 11 th century up to the time of Bu-ston in the 14th century. The part which treats this history in Bu-ston' s text rGyud-sde 'j zab-don sgo- 'byed rin-chen gces-pa'i ldemig, short title Dus- 'khor chos- 'byung, "A History of Kiilacakra" written in 1329 is primarily presented. 116 Bu-ston has written numerous texts on the Kiilacakra. Five out of the 28 volumes of his Collected Works are devoted to this subject. He has commented on the basic texts and written about most of the topics which comprise the Kiilacakra tantric system, among them is to be found the present text about the history of the doctrine. As mentioned above, Newman has translated p.56-61 of the "History of Kiilacakra" by Bu-ston. ll7 These five pages contain the history of the introduction of Kiilacakra to India from the mythic land of Shambhala. 1I8 Starting with the version from the Rva school of

Naudou. 1968:160-161. Note 119 below. 115 Toh. 361. 116 Bu-ston, 1965d:56-74. 117 See above p,19. 113

Kalacakra. The Indian pandit Cilu is first mentioned. His disciple was Pido Acarya (or; PilJejo acarya), who taught the whole Bodhisattva Corpus. I 19 After Pi1Jejo came Kalacakrapada, the Elder and then Kalacakrapada, the Younger, who is also called Naropa (or: Nalendra_pa).120 Somanatha, who founded the 'Bro school of Kalacakra and brought it to Tibet, received the Kalacakra tradition from both the Elder and the Younger Kalacakrapada. I will not here treat all of Newman's arguments, but concerning the identification of these masters, he establishes with some conviction that Kalacakrapiida, the Elder should be identified with Pi1Jejo. Using Atisa 's Bodhipathapraejipa with commentary as a source, Newman also identifies Kiilacakrapiida, the Younger, with Niido (Niiropa) , whose death has been calculated to 1040. l2l Consequently, the appearance of the Kiilacakra Tantra in India probably happened in the early part of the 11th century. There is a date, 1012 A.D. or 1026 A.D. 122 which is mentioned in the laghutantra in the form of a prophecy. Therefore, it is not absolutely certain that this text was written after this date, it could also have been written previously. Orofino mentions the 60-years-cycle 967-1026 which seems quite possible.123 As the date of the death of Niiropa has been quite well established as 1040, this seems quite probable. This means that it is difficult to accept the Kiilacakra Tantra being introduced to Tibet as early as 1027, the date mentioned by most Tibetan commentators, but probably somewhat later in the 11th century. Ariane Macdonald was the first to argue for a later dating of the introduction of the tantra to Tibet. She wanted to set the date of the introduction of the Kiilacakra to Tibet to the last 25 years of the 11th century, after Atisa, whom she considered had played no role in this introduction. 124 The latest contribution to the discussion is an article by Newman where he, after a very thorough investigation, reached the conclusion that the mleccha year of 403 mentioned in KCT 1:27 and VP 1.9.27 corresponds to the year 1024/25 or 1026/27 AD. This 118 The correct spelling of the original word in Sanskrit is Sambhala as it is found in that form in the original Sanskrit texts (first remarked by Reigle. 1986). In the Tibetan translations Sambhala became Shambhala for an unlolOwn reason. Perhaps it was phonetically easier or there was an older tradition of also writing Shambhala in Sanskrit? In correspondance with John Newman (21.6.-04) he remarks that Shambhala probably is an east Indian pronunciation. In this dissertation I will use the Tibetan spelling Shambhala as I will use the concept in the Tibetan context. This consists of the following three texts; Vimalaprabha (Toh.134 7) by Kalki Pundarika, HevajrapilJl!artha!fka by Bodhisattva Vajragarbha. a text belonging to the Hevajra system (Toh.1180, Peking 2310); and Lak,abhidhanaduddhrta-Iaghutantra-pilJl!arthavivarana-nama by Bodhisattva Vajrapa(!i, a text belonging to the Cakrasamvara system. (Peking 2117). These three texts all comment on the abridged (laghu) tantras of Kalacakra, Hevajra and Samvara systems. According to Newman, the latter two explain their tantras in accordance with the special ideas of the Kalacakra. They have corresponding passages and doctrinal and stylistic features in common. (Newman. 1987a:77, 111). These texts have often been grouped together in these tantric traditions. 120 This is the Tibetan word for the monastery of Nalanda in northern India where Naropa was active. 121 Wylie. 1982:687-692. 122 Schuh. 1973:20,121; Newman. 1985:65,85 no(eI3; Newman. 1987:538-39 and Orofino. 1994:15-16 who convincingly argues that the date should be 1026 and not 1012. The latest and most comprehensive investigation of the dating problem of the Kalacakra texts has been made by Newman. 1998a. 123 Orofino. 1994a:15-16. 124 Macdonald. 1970:175.

means that these texts must have been completed after these dates, between 1025 and ca. 1040 AD.12S This dating seems correct and hereafter well established. As we have seen above, Newman found just one allusion to the Kalacakra in the main texts of Atisa. Above the problem of dating the introduction of Kalacakra to Tibet has been treated. The introduction probably took place between 1030-1040 (p.13-20). The part of Dus-'khor chos-'byung that I have translated is p.61-74 in the Lokesh Chandra edition (fol.3l a-37b). It contains the history of the 'Bro-pas and the Rva-pas, the two main Kalacakra schools. The text begins with the 'Bra school (p.6l-65, fo1.3la-33a). [When nothing else is stated, the facts are from Bu-ston's text.] At the end of the preceding chapter of Bu-ston's text, the Kasmzrz Somanatha is introduced as a disciple of both the Elder and Younger Kalacakrapadas in Magadha and he received the whole Bodhisattva Carpus. 126 It is also told that he was involved in a debate with the Kasmzrz scholar Ratnavajra (Rin-chen rdo-rje).127 This Ratnavajra was a well-known Buddhist scholar and was one of the six "gate-keepers" of the VikramaHla monastery in northern India. He was one of the two at the centre, together with Jflanasrfmitra, which means that he was one of the leaders of the monastery. He was also known as acarya KanJa-pa before receiving his initiation name. 128 There is an interesting dating which says that Ratnavajra was gate-keeper during the reigo of the Pala king Canaka (955-983) and was a contemporary of Naropa. 129 Somanatha won the debate in question and Ratnavajra told Somanatha to go elsewhere, otherwise his disciples would lose faith in him. Somanatha then considered that he would spread the Kalacakra to Tibet and went there. 1JO It is very difficult to conciliate the dates of Naropa with this event. The dating of Naropa is very uncertain and the above dating of Ratnavajra is also uncertain. It is more probable that Naropa lived later and possibly Ratnavajra also lived later and it is possible that this story is credible, but that it took place some years later. The foregoing shows that Somanatha had made a powerful enemy and the question is whether he went to Tibet voluntarily or in "exile", because he had made some religious offense against Ratnavajra who held a position of power. The position of Somanatha in the VikramaHla is not clear from the context. There is an obvious dating problem because Somanatha is generally considered to have lived later. If Naropa died in l040 imd the identification of him with Kalacakrapiida, the Younger, by Newman is correct, then Somanatha was active as a disciple of Naropa not later than 1040 in VikramaSZla. Then again, if the traditional dating of the arrival of Somanatha to Tibet in 1064 131 is correct, we have to calculate that Somani'itha was at least Newman. 1998a:342-343. See note 119. 127 Newman. 1985:71. 128 Roerich. 1949153:372,378,869; Taranatha. 1868/69:240-41; Naudou. 1968:139; Niiropa was also one of the gate-keepers. 129 Dutt. 1962:361; Naudou. 1968:139-141, Taranatha. 1868/69:234-243. The six gatekeepers at the period 955-983 were: I. iiciirya Ratniikarasiinti of the Eastern Gate; 2. Viigfsvarakfrti of the Western Gate; 3. Niiropa of the Northern Gate; 4. Prajfiiikaramati of the Southern Gate; 5. Ratnavajra in the central gate. 6. Jfiiinasrfmitra of the second central gate. Bu-ston. I 965d:60, Newman. 1985:71. 131 Bod-rgya tshig-mdzod chen-mo. 1985:3216.

in his seventies when aniving in Tibet, probably in his eighties. Again, this is not possible because it is difficult to understand that he would have had his doctrinal debate with Ratnavajra and gone to Tibet when he was more than eighty. If Ratnavajra was born around 940 and died after 986, as suggested132, it is not possible that Somanatha anived in Tibet in the year 1064 as in the texts it is supposed that he left India soon after his debate with Ratnavajra. The Kiilacakra master Bodhibhadra, a disciple of Niiropa and a contemporary of Ratnavajra, was teaching around the year 1000 CE and lived after that for some time collaborating with Gyi-jo. \33 This makes the debate between Somaniitha and Ratnavajra virtually impossible if the former was active in the 1060s. The solution to this problem is either to change the dating of Niiropa and Somaniitha or to accept that Niiropa was not identified with Kiilacakrapiida, the Younger. Perhaps there is also another Ratnavajra than the one mentioned in the sources. In conclusion, it can be stated that the datings of the first masters of Kiilacakra are uncertain. The text continues with Somaniitha arriving at gNyos and initiating the translation of the Vimalaprabhii supported by the local ruler Ye-shes-mchog. 134 There he did not translate more than half of the commentary because he was not given the 100 golden srang J35 that he was promised. In tantric Buddhism, the practice ofgiving money in order to get acess to special teaching is not uncommon. The donation was for the initiation to the tradition and the access to the texts. Especially the Tibetans going to India had to collect quite a large amount of gold to obtain teaching from Indian masters. This custom is in the Tibetan tradition itself, and is a way of showing respect to the guru and a sign of your willingness to give all that you have for the sake of religion. It is also stressed that the guru will not use this wealth for his own good but to build shrines and other religious purposes. Somaniitha then travelled to 'Phan-yul and there he met 'Bro lo-tsa-ba and completed the translation of the Vimalaprabhii commentary. This is the canonical translation found in the bsTan-'gyur. Comparing these facts to Nyang-Ral's text makes some problems evident. There it is said that 'Bro invited Somaniitha in order to translate the great and small commentary and there is nothing stated about Somaniitha first going elsewhere. At least the two texts agree that they translated the Vimalaprabhii. Nothing is said about translating the Laghutantra (KCT). The problem of course could be only one of omission of information, but still, it would have been probable that Nyang-Ral would have mentioned if they also translated the basic text. There remains a doubt as to when Somaniitha made this translation with 'Bro of the KCT. 'Gos-lo-tsa-ba and Bu-ston mentions that Somaniitha went back to India for three years and then to Tibet a second time, which means that he had a connection with Tibet under a long time period. 136 Eventually, Somaniitha had several disciples, among ~hem sGom-pa dKon-mchogsrung, to whom he gave all the Kiilacakra teachings and from whom he received some

.

132 Naudou. 1968: 129,139. Ratnavajra was also the teacher of Rin-chen bzang-po (980-1055). Ratnavajra is said to have supervised the work of reconstructing the bSam-yas monastery after it had been burnt in 986. He was doing the work of an architect (The Blue Annals. 1949153:378). IJJ Naudou. 1968:151-154. Naudou writes convincingly about the dating of these early masters and there is no reason to doubt his conclusions concerning Bodhibhadra. 134 See my notes below 165 and 173-74. 135 Srang was a monetary unit in ancient Tibet. 136 Roerich. 1949153:760; Bu-ston. 1965d:62, line 4 and my translation below (p.38-39).

gifts and some gold. The next name in the lineage is sNor-bzang-gi sGro-gNam-la-brtsegs. He had some conflicts with Somaniitha, who at fIrst only gave him the Pratimqk~a precepts, so sGro nrst received the Kiilacakra teachings from sGom-pa, but eventually he also received them from Somaniitha. In the lineages usually given there is the line:Somaniitha - 'Bro - sGom-pa, 137 but in this text by Bu-ston there is no indication that sGom-pa was ever a disciple of 'Bro. The name 'Bro is mentioned only once in connection with the translation of the Vimalaprabhii, and not as the teacher of sGom-pa. Mention can also be made of the fact that 'Gos lo-tsaba in an abbreviated lineage of the 'Bro school does not mention 'Bro's name in the lineage, which is as follows: Somaniitha - sGom-pa - sGro. 138 It is diffIcult to draw any conclusions from this but probably the 'Bro school has its name because of his merits as a translator and not as much for his being a guru and lineage holder. Next in the guru lineage given by Bu-ston is Yu-mo. It is stated in the text that he was given his name by Bar-ston Thos-pa-dga', which is also the personal name of Mi-Ia-raspa. It is possible with the dating of Mi-la-ras-pa (1040_1123)139 and Yu-mo in the second half of the 11th century and the beginning of the 12th century140 that it could be Mi-la-raspa. This could point at an interesting connection between bKa'-brgyud-pa, Kiilacakra and the Jo-nang-pa. Yu-mo was the founder of the Jo-nang-pa school and also the founder of the controversial doctrine of gZhan-stong ("substantialism"), although the doctrine was not written down until Dol-po-pa (1292_1361).141 Yu-mo studied with many lamas and particularly his guru was bLa-ma sNor-bzang, but he also received Kiilacakra teachings directly from Somaniitha and he became a great master of Kiilacakra and taught extensively. He died at the age of eighty-two. Recently, texts have become accessible which may make his life more known. 142 When Yu-mo was fIfty-fIve years old, his son Dharmesvara became his disciple; next in the guru lineage was DharmeSvara's disciple Nam-mkha '- 'od. His disciple was DharmeSvara's son Nam-mkha' rgyal-mtshan and the latter'S successor was 'Jam-gsar, who in his tum gave the Kiilacakra teachings to bLa-ma rGa-Io. Information about these last fIve representatives of the 'Bro lineage is very scarce and not much more is known than the names. All of them were masters and main lineage holders of the Jo-nang-pa schooI. 143 It is interesting that the Jo-nang-pas should have such a prominent place iIi. the history of Kiilacakra. It points out that these very complicated Kiilacakra

Roerich. 1949/53 :765-788. Roerich. 1949/53:755-756. 139 Snellgrove. 1987:488 and Stein. 1984:49. As far as I know there is no mentioning of Mila-ras-pa having contact with the Kiilacakra Tantra. 140 Ruegg. 1963:73-91. See Steams. 1999:199-200, note 10. In a text on the life of Yu-mo, Steams has found that Yu-mo was born during the first cycle of 60 years of Tibetan chronology based on the introduction of Kiilacakra to Tibet in 1027. Consequently, he was born before 1087 and after 1027; a dating which actually corresponds well with other sources. 141 Ruegg. 1963:77. 142 Steams. 1999:200, n.lO. 143 Ruegg. 1963:80; Roerich. 1949/53:766-67. It can also be noticed that the tanlric cycle of Yamiintaka was continued by the same lineage of masters beginning with the one who first received the teachings from India, Rva-lo-tsa-ba rDo-rje grags (Roerich. 1949/53:379). 137 138

doctrines could be interpreted in very different ways. The doctrines are important for the development of their gzhan-stong doctrine. 144 . Another interesting fact is that Bu-ston ends his history of the 'Bro .school with rGa10 (1203-1282), who could not possibly have been his own teacher. 145 One possible reason, as shown later, is that rGa-lo was an important guru also in the Rva school of Kiilacakra and that Bu-ston considered that the Rva and 'Bro schools were united in the person of rGa-lo, and therefore only treats rGa-lo and his disciples in connection with the Rva school. He might have considered that the 'Bro school ceased to exist separately with rGa10, and that after him there was no point in treating different schools of Kiilacakra. In the biography (rnam-thar) of Bu-ston, translated by Ruegg, it is directly stated that Bu-ston was making a synthesis of the two schools Rva and 'Bro. He summed up the opinions of the two schools as well as others into the essential practice of the Kiilacakra methods. 146 In contrast, 'Gos lo-tsa-ba considered that the 'Bro school continued up to his own time, but rGa-lo is not included at all in his guru lineage of the 'Bro school, only in the Rva. 147 It is consequently worthwhile to continue researching the lists of tradition h()lders. It can also be noted that The Blue Annals mentions Dol-po-pa (1292-1361) as an important lineage holder and Bu-ston (1290-1364) does not mention him at all. 148 Perhaps that is not too strange as they were contemporaries, but it is also known that there existed a doctrinal conflict between the two. It concerned the gzhan-stong, "voidness of other"-theory of "substantialism" propagated by Dol-po-pa and the orthodox Miidhyamika theory of rang-stong I "emptiness in itself' held by Bu-ston. This was the most important doctrinal debate of the 14th century. The gzhan-stong theory had its origin in the 12th century with Yu-mo, but was not put into writing until Dol-po-pa wrote his treatise Ris-chos Ilges_don. 149 This may now be studied with the pUblication of The Collected Works ofDolpo_pa. 150 Recently, a new basic work on the life of Dol-po-pa and his doctrines has been published, shedding new light on this important figure in the religious history of Tibet. 151 The Rva school is treated on p.65-74 in the Indian edition (foI.33a-37b) of Bu-ston 's Dus- 'khor chos-byung. The lineage starts with the Indian Pandita Samantasrf, who was invited to Tibet by Rva lo-tsa-ba Chos-rab. Rva Chos-rab's uncle was Rva lo-tsa-ba rDorye-grags a famous master especially in the Yamantaka tantric teachings. He founded a school, as it is said in the text that Rva Chos-rab learned all the texts and precepts of the Rva-pas (the Rva school). 152 Rva lo-tsa-ba Chos-rab then travelled to Nepal and there stud-

144 Ruegg. 1963:75,85; For more on the gzhan-stong teachings see Steams. 1995 and 1999 and also the interesting article by Mathes (Mathes. 2000). 145 For information on rGa-lo see Macdonald. 1970:182; Ruegg. 1966:42-43,88; Roerich. 1949/53:789-793 and the present text (p.46-54). 146 Ruegg. 1966:86-88. 147 Roerich. 1949/53:755-756,765-788. 148 Roerich. 1949/53:775-777; Ruegg. 1966: index; Bu-ston. 1965d:73-74. 149 Ruegg. 1963:80-83. 150 The Collected Works of Dol-po-pa with an Introduction and Catalogue by Professor Matthew Kapstein. 151 Steams. 1999:43-46 for a discussion of the gzhan-stong traditon and its relation to the Kalacakra tantra; p.56-59 for a general discussion of the influence of Kalacakra on the teachings of Dol-po-pa; p.118 and notes on p.238-39 for a very interesting discussion of the concept of Adibuddha as interpreted by Dol-po-pa. 151 Roerich. 1949153:374-379, and Snellgrove. 1987:505-506 for biographical notes on Rva lo-tsa-ba rDo-

ied the Kiilacakra with Samantasri. He then invited Samantasrf to Tibet and received the explanations of the Vimalaprabhii and the $wjangayoga. After some time, havingleceived some gold and given many instructions on the Kiilacakra, Samantasrf returned to Nepal. The dating of Rva Chos-rab is not completely clear. He is supposed to have participated in a Buddhist council in mNga'-ris in the year 1076,153 but Ariane Macdonald gives his date of birth as 1070 which does not agree with other infonnation. 154 His uncle Rva rDo-rjegrags lived in the second half of the 11 th century and consequently, Rva Chos-rab probably lived a little later, in the second half of the 11th century and the fIrst half of the 12th. The uncle was one of the most famous and richest of the Tibetan scholars bringing back teachings from India and, as in this case,from Nepal. The dates of Samantasrf are not defInite either. He must have lived in the second half of the 11th century, but it is diffIcult to arrive at a more precise date. The "son" of Rva Chos-rab was bLama Ye-shes seng-ge, and his son was Rva Bumseng. These two are just mentioned very briefly. The bLa-ma rJe-btsun rGa-lo rNam-rgyal rDo-rje acquired the teachings of Kiilacakra from Rva Bum-seng, and about this rGa-lo no less than fIve pages are written (p.65:7-71 :5), which is out of proportion when compared to the space given to other names in the guru lineages. Consequently, he was considered a very important person by Bu-ston. His family is traced back to the old aristocracy of Tibet to a man from Mi-nyag brought to Tibet by the ministers sBa-gsal-snang and Sang-shi at the time of king Khri-srong ldebtsan in the 8th century. 155 Later, the family came to stay at a monastery called dBen-dmar in gTsang, whose abbatial seat then was inheritated by members of the family. rGa-lo rNam-rgyal rDo-rje was considered to be the incarnation of Khams-pa rGa-Io-tsa-ba gZhon-nu-dpal (1110/14 - 1198/1202). In the Blue Annals there is only one rGa-lo indexed, but it is obvious that two existed. The second, rGa-lo rNam-rgyal rDo-rje, lived in the 13th century (1203_1282).156 He is the fIrst to be properly dated in Bu-ston 's text and it is the same dating as given in the Blue Annals. rGa-lo met Kha-che Pan-chen ISiikyasrfl at Ngur-smrig in gTsang when he was three years old, and Kha-che prophesized about rGa10 's future success. Then more stories follow on the life of rGa-lo and it is diffIcult at times to understand why they are included in this text. 157 rGa-Io studied Sanskrit and the great commentary of Niiro with dPyal Chos-kyibzang-po.158 He received instructions from both the Rva and the 'Bro school and received teachings from Sa-skya Pandita, Vibhuticandra, Khro-phu lo-tsa-ba and dPyal A-mo-gha. Some of his main disciples were Man-lung gu-ru, IHo-pa grub-seng, Thang-ston 10tsa-ba and mKhan-chen Khro-phu-ba. From all the names mentioned in the text, one can rje grags. There exists also a special biography of him recently published in India. On Rva Chos-rab see for ex. Roerich. 1949153: 756, 765,789. 153 Roerich. 1949153:378, here 'Gos lo-tsa-ba must have made a mistake in talking about Rva Chos-rab as the one who helped Ratnavajra to rebuild bSam-yas after it was burnt in 986. It must have been his uncle Rva 10tsa-ba rDo-rje grags; Bod rgya tshig mdzod chen mo. 1985:32 I 7. 154 Macdonald. 1970:181. 155 Macdonald. 1970: I 82. 156 Macdonald. 1970:177-179; Roerich. 1949153:790,796 and Bu-ston. 1965d:66,73. 157 Bu-ston. 1965d:70, 71 the story about the imitative magic. 158 This must be the Sekoddesa!ikii.

conclude that rGa-Io was acquainted with most of the great traditions of his time. He met Sa-skya Pa1Jq,ita, who was the bla-ma that was sent to deal with the Mongols and together with his nephew,'Phags-pa, received the power to govern Tibet in the 13th century. The monastery of Sa-skya is also quite close to dBen-dmar, both situated in the gTsang province. There are some interesting examples of imitative magic practised by rGa-Io. He acted as a sort of healer and when someone had a tooth-ache, rGa-Io filled in a crack in" the fireplace and the ache disappeared. When someone had a head-ache he took out some nails from the door and it helped. Another technique was when someone was dumb and could not walk, rGa-Io gave him other clothes and changed his name and so he was cured. This kind of healing was evidently something that was practiced in 13th century Tibet. Likely to be examples of popular medicine/magic, it is difficult to see any connection with classical Buddhism, but rGa-lo was apparently famous for his healing abilities (see below, p.54). rGa-lo's eldest son rGya-gar-grags-pa subsequently learned the Kiilacakra and occupied the abbatial seat of dBen-dmar. The son, bLa-ma Shes-rab seng-ge, was born in 1251 (see below, p.55). He also leamed the Kiilacakra and took over dBen-dmar from his brother. He founded the monastery of Shangs-bar and spread the Kiilacakra to, among others, the Ti-shri bLa-ma who at the time was the regent of Tibet for the Mongols in the name of the Sa-skya-pas. The next son of rGa-la, A.-ka-ra siddha, received the Kiilacakra teachings of the Rva and 'Bra schools. He also received teaching from the Sa-skya-pas and the dPyal-pa school, which is evident from his two teachers with dPyal in their names. The dPyal-pa was quite a respected school in Tibet, but little known. 159 The next in the guru lineage was the son of A.-ka-ra siddha named bLa-ma rDo-rje rgyal-mtshan (1283-1325) (see below, p.57). He studied the Kiilacakra intensively and also took possession of dBen-dmar. He was invited to China in 1322 and went there the same year. It appears that he died in China in 1325, as it is never mentioned that he returned to Tibet. It was a custom of the Mongol emperors of China to invite learned Tibeten bla-mas to Peking, as they had a strong connection with Tibetan Buddhism since the time of 'Phags-pa. There the concept of chos-srid, the relationship between a lay protectoriking and his religious councellor, developed," between the Mongol emperors and Tibetan blamas starting with Sa-skya Pandita and 'Phags-pa. Quite a few bla-mas went to Peking at this time, among them several of the Karma-pa incarnations. Consequently, he was far from being alone in being invited like this, but it also means that he had reached a certain position among the clergy in Tibet in order to be known well enough to receive an invitation. If he gave instructions on the Kiilacakra in Peking is not stated in the text, but it is possible as the Kiilacakra texts are also translated in the Mongol bKa'-'gyur and bsTan-'gyur. In China proper, the Kiilacakra has remained unknown, as there is no translation of the Kiilacakra texts in the Chinese buddhist canon. To conclude, Bu-ston himself was a disciple of rDo-rje rgyal-mtshan and he also states that he had a Kiilacakra teacher with the title mKhan-po lo-tsa-ba, whose doctrinal affiliation is unknown. Bu-ston later came to be considered one of the main tradition holders of the Kiilacakra, probably the most appreciated of all. He commented on a variety of Like theRva family, the dPyal family was one of the old families/clans (rus) of the old Tibet in the 711> to the 9th century.

themes in the Kalacakra and dedicated five vohnnes of his collected works to them. Bodong phyogs-Ias rnam-rgyal, Tsong-kha-pa, mKhas-grnb-rje and consequently the dGelugs-pa school tradition of Kalacakra in modem times with Dalai Lama XIV h~ve their tradition of Kalacakra from Bu_ston. 160 As he united the Rva and 'Bra schools in his works, there is not much mention of these two schools after him. 161 Consequently, there are good reasons for studying Bu-ston 's commentaries to the Kalacakra texts. Finally, Bu-ston gives a short lineage of the third of the three traditions that he considered the most important in the transmission of the Kalacakra, namely the Gyi-jo school. It starts with Dus-zhabs-pa (Kalacakrapada) and continues with Sri Bhadrabodhi, who gave the Kalacakra teachinga to Gyi-jo Zla-ba'i 'od-zer. Then Bu-ston gives the names of several bla-mas who continued the tradition, but he also states that the Gyi-jo tradition was not continued after these disciples. Consequently, the Gyi-jo tradition had only minor importance for the later development of the Kalacakra. Although Bu-ston also states thatGyi)0 's disciple Se lo-tsa-ba gave the teachings to gNyos 'od-ma, from whom the rTsa-mi tradition originated, the rTsa-mi tradition is not well known, but Kalu Rinpoche of the Karma-pa school gave several Kalacakra initiations at the end of the 1970s and the beginning of the 1980s and he states that his tradition of Kalacakra was of the rTsa-mi school. 162 Within the Karma bKa'-brgyud-pa, this tradition has consequently continued. Although this tradition merits further study, that is not possible within the scope of the present study. The following chapter will present Bu-ston's text in an annotated translation.

2.2.3. Bu-ston's text: Dus-'khor chos-'byung - A history of Kalacakra.

A translation from: rGyud-sde 'j zab-don sgo- 'byed rin-chen gces-pa'j Ide-mig, "The opening of the door of the profound meaning of the tantras called: 'The key of the excellent jewel'." By Bu-ston 1329. Short title: Dus- 'khor chos- 'byung, "A History of the origin of Kalacakra." In: The Collected Works of Bu-ston, ed. by Lokesh Chandra, New Delhi 1965, Part 4, p.I-92 (Here, p.61-74 are translated). Here follows the translation ofp.61-74 which treats the history of Kalacakra in Tibet up to the time of Bu-ston himself. He wrote the text in 1329.

Roerich. 1949/53:793-795 and Bu-ston. 1965, yoU-5. For ex. see Ruegg. 1966:86-88, where Bu-ston is said to be synthesising the opinions of Rva and 'Bro. 162 Kalu Rinpoche. 1986:6. rTsa-mi Sangs-rgyas grags-pa also acted as a translator as shown with the text Avadhutayoga-nama-adibuddha-sadhana by Kalacakrarati-pa. He translated the text together with Kalacakra, the younger (Dus-kyi 'khor-Io zhabs chung-ngu). See below p.60. 160 161

(p.61 :2) 3, The school of the 'Bro-pa and the school of the Rva_pa,163 1, [The 'Bro school :] . 164 After that the Kasmfrf Somaniitha had arrived in Tibet, he settled with gNyos of Kha-rag 165 and translated the commentary Vimalaprabha 166 (p.61 :3), being promised 100 golden srang,167 [but] being discontent, [he] did not translate more than half of the commentary.

"'These two schools were considered to be the most important from the introduction of Kalacakra up to the 14th/15th century. There is another school, rTsa-mi, considered as the third important school especially in the bKa'-brgyud-pa tradition. (Kalu Rinpoche. 1986:6) 164 Tib. Kha-che Zla-mgan [Zla-ba mgan-paJ. Samaniitha can be considered the founder of the 'Bra school of Kiilacakra. He probably came to Tibet around the middle of the 11th century (Newman. 1985:70-71 and Newman. 1987a:88-89). According to the Bod rgya mlshig mdzad chen ma Part 3 (p.3216), he arrived in Tibet in the year 1064, a year probably calculated from Deb-ther sngan-pa. In order to obtain an idea of the context of this text I hereby quote from Newman. 1987a:88-89, where he has translated p.56-61 of the Dus'Ichor ehas- 'byung. "At that time Somanatha, the very intelligent son of a brahman, was born in Kashmir. For twelve years he learned his father's heterodox dharmas, but his mother was a buddhist and she told him that he should study her religion. She put him under tutelage of the Kashmiri pandit called "Brahmanapada" (Bram ze zhabs). Since Somanatha was very handsome, the pandit's daughter said: "You must have intercourse with me in order to listen to the Dharma." Somanatha accepted that and listened to a lot of Buddhist Dharma. At that time Kalacakrapada the Elder's disciple Vinayakaramati (Dul ba'i blo gros) sent the Sekkodesa and a commentary on the Sekaprakriya to Brahmanapada, Brahmanapada showed them to Somanatha, who read and admired them a lot. Somanatha went to Magadha, met the Elder and Younger Kalacakrapadas, and received instruction on the doctrines of the Bodhisat):Va Corpus. At that time Somanatha became involved in a debate with the Kashmiri scholar Ratnavajra (Rin chen rdo rye), and won. Ratnavajra told Somanatha that he should go elsewhere lest Ratnavajra's disciples lose faith in him. Somanatha acquiesced, thinking that he would spread the Kalachakra in Tibet, which he did." For my discussion of Samaniitha and Ratnavajra see the foregoing chapter. See also Roerich. 1949153:765-767, 165 Kha-rag gNyas La-tsa-ba was according to 'Gas La-Isa-ba's Blue Annals a translator of the Kiilacakra Tantra. It is said that he translated the Kiilacakra after Samaniitha's arrival to Tibet with financial support from Kalyiinamitra ICe-pa from bZang-yul and his son. They gave 60 golden srang to gNyas and he made the translation in one year. (Roerich. 1949153:373,837,906.) Consequently; gNyas of Kha-rag is a person, not a place. gNyas is the name of a clan. The two stories of Bu-stan and 'Gas La-Isa-ba do not agree on how this translation was made, In Bu-slan's text Se La-tsa-ba is only mentioned by name at the end of the text as a translator and nothing is said about him financing Samaniitha:s translation. It is difficult to reconciliate the two versions. A qualified supposition is that the version by Bu-stan is more correct as it is older and generally reliable. Kha-rag is a place-name, but I have not found it on the available maps. 'Gas La-tsa-ba writes about Kha-rag (Roerich. 1949153:207,522,675), which seems to be a place name, but also the name of a mountain. The location of the mountain is probably near Sa-skya in gTsang. There is a system of teaching called Kharag-pa after a bLa-ma Kha-rag sGam-chung who lived at a place called Kha-rag phug-pa nag-po. There was also a mountain called Kha-rag. From the context it could be deduced that it was not far from 'Phan-yul . Roerich. 1949153 :999-1 005. 166 Tib. Dri-ma med-pa'i-'ad. P. 2064 and Toh. bKa'-'gyur 845, bsTan-'gyllr 1347, This text has a unique position in the canon together with the laghutantra (P.4 and Toh.362 and 1346) in that they are included both in the bKa '- 'gyur and the bsTan- 'gyllr in the sDe-dge edition. 167 It could be that the figure should be 8 instead of 100, brgyad instead of brgya? The difference is small in Tibetan script and it would fit better with the 18 golden srang mentioned later in the text. (p.61 :5). Srang is a coin used in Tibet. I srang = 10 zhao The value of I golden srang is difficult to know but it had a quite high . value. Srang is also measure for weight, approximately I ounce. (Das. 1903:1287) (Bod rgya mtshig 'dzad chen mo. 1985:2969).

35

After having seized the rest of the translation to be made, he [i.e. Samanatha] travelled to Grab 16B in 'Phan_yul. 169 [There] Zhang-pha chung-ba l7O took [Samanatha] as his bla-ma, and 'Bra,171 after having been made the translator, translated [the rest] completely, with perfection. As it was said by gNyas to Zhang-stan: "Because you robbed me of my bla-ma, I am going to stuff small grains of rape in between the threads of the cloth of a nomad-tent.,,172 (p.6l :4)Then, after having said:"Even after being threatened by hundreds of wrathful deities, I was not destroyed, and even after being shown the smile of hundreds of goddesses, I didn't have desire", he [Zhang-stan] was served [by them]. 173 [Then] gNyas-stan Ye-shes mchag gave [Samanatha] 18 golden srang. 174 (p.61:5) [Then] Gra-pa mngan-shes 175 donated provisions for three years of Chas-stan [to Samanatha], [and] when they met he continuously showed respect. Ja-btsun Tshul-khrims rin-chen gave [Samanatha] six golden srang. [And] gYa-ru 'Gar-stan, Mang-yul stan-ma sri-dar and sMan-gra'i 'jam-sgam and

168 'Phan-yul is a district just a little bit to the north-east of Lhasa. Wylie. 1962:map. Grabs-yul was the designation of a place at the time of the early six tribes of Tibet (Bod rgya rntshig mdzod chen mo. 1985:396). I have not found any infonnation on Grab on the maps. 169 It is probably meant that Somaniitha seized both his finished' translation and the unfinished half with the original text and left the place Kha-rag. There was evidently a conflict concerning money with this gNyos who was the person that should have paid him. 170 There is a Zhang-chung-ba mentioned by 'Gos Lo-tsa-ba (Roerich. 1949153:311,314). He was a disciple of the Kalyanarnitra sNe'u-zur-pa (1042-1118) who is mentioned after treating AliSa and his lineage. This master's monastery was sNe 'u-zur in 'Phan-yul, so there is a connection with 'Phan-yul. The time in the second half of the I I th century is also correct. The connection with Atisa is also clear. 171 'Bro Lo-tsa-ba Shes-rab-grags can be dated from the context to the second half of the 11 th century. He is the canonical translator of several texts in the bKa'- 'gyur and bsTan- 'gyur together with Sornaniitha and the 'Bro school of Kiilacakra is named after him. 172 I have not found an explanation to this obscure statement. It is obviously some sirrrile, but the meaning is not clear. The Tibetan text: "khyod kyis nga'i blli rna 'phrog pa yinpas sbra gseb tu yungs kar rtsang nge ba zhig bya yi zer ba la." De-ba = a medicinal herb (Jiischke), rtsang = rdzang = to stuff something into something.(Jiischke) Yungs-dkar = grain of white mustard (Jiischke) or according to Tarab Tulku "grain of rape". sbra = the cloth that the nomad-tents are made of, gseb-tu = between (Jiischke). There is, though, a hint at a solution of the meaning of the saying in the Sarnvarodaya-tantra (Toh. 373) where it is written in connection with describing the benefits with making the homa offering, that "white mustard pacifies (calamities)". The conclusion of this is that gNyos was making some sort of ritual to pacify the calarrrity that Zhang-ston had robbed him of his bla-ma. 173 Obviously there was a conflict here between gNyos and Zhang-ston about who was going to be Somaniitha's host. gNyos thought that he was first and wanted to keep Somaniitha, but it seems like Zhang-ston won the conflict as he resisted the temptations put forward by his adversary. 174 Here there must have been some reconciliation between Somaniitha and gNyos, provided that this gNyosston Ye-shes-mchog is the same person as the gNyos mentioned earlier in the text. gNyos-ston sives gold to Sornanatha, which could mean that he paid some of his debt to Somaniitha for the translation ofthe texts. l75 His dates are 1012-1090 according to Roerich. 1949153:95-97,262,755,852. Newman. 1987:103. The uncle of Gra-pa mngon-shes was a Zhang-ston chos- 'bar from whom he had learned the Kiilacakra in his youth. Gyi-jo Zla-ba'i 'od-zer was a translator working with Zhang-ston. Consequently the Kiilacakra was already known to Gra-pa mngon-shes when he met Sornaniitha. Gra-pa acted here as a donator and paid three years of retreat (chos-ston) for Somaniitha. For the general role of the lay donator in relation to his spiritual, religious adviserlgum see the recent work by Ruegg (Ruegg. 1995).

36

others, 176 (p.61:6) even after having made great service [to Somaniitha], [they] were not . given other [teachings] than the rules of conduct. 177 sGom-pa dKon-mchog-srung I78 who was born at Grab in 'Phan-yul, collected all his wealth, assembled [it in the forin of] six golden srang [and] gave [them to Somaniitha], (p.61:7) [and he] tied a silk scarf 1790n [[[Somanatha's]]] neck, and having offered the body,180 . [he] rendered service [to Somanatha]. Because he [sGom-pa] was accomplished iri the way hoW to explain the great qualities of Abhidharma 181 and Sa_sde l82 and medicine and so forth he [sGom-pa] received the basic text and the manuals without exception [from So, 183 manatha]. . (p.62: 1) After that, sGro sNam-la-brtsegs from sNor-bzang,184 after having taken provisions and one phul 1850f turquoise to dGe-pa-shes Lo-ro-ba of sBu-sde, 186 he [sGro] was made a disciple [of Lo-ro-ba] between twenty-six and fifty-eight years of age. ,7' Four names are given in this context, relating that they did not receive the Kiilacakra teachings although they had tried; another proof of the relative inaccessibility of these teachings. I have not found infonnation on any of them, only that one of them obviously came from Mang-yul near the Nepalese border. '77 Here the stress lies on how difficult it was to get the higher tantric initiations from Somaniitha. No matter how much they served him, they still could not obtain more teaching than the rules of conduct (skt. prati-

molqa). ,78 He was bom at the same place where Somaniitha had gone to meet 'Bro and Zhang-ston and probably this was the place where he met Somaniitha. Orab in 'Phan-yul must have become an important centre for the Kalacakra teaching in Tibet. The sum of 6 golden srang is a good indicator of the value of the Kiilacakra teachings. The other sums mentioned in the text are; 100 (8?) golden srang promised to Somaniitha from Kha-rag gNyos, 18 golden srang was given to Somaniitha by gNyos-ston Ye-shes mchog, Jo-btsun Tshulkhrims rin-chen gave Somaniitha 6 golden srang, sOro sNam-la-brtsegs gave 12 golden srang (and a black horse) to Somanatha for the Kiilacakra te!\chings. The highest sum mentioned in this text is the 300 golden srang given to Samantasri by Rva Chos-rab. Otherwise there are no more sums mentioned. It seems like the giving of money and wealth was restricted to the Indian teachers. In Tibet there are no sums mentioned. More about sOom-pa can be found in Roerich. 1949/53:755, 766-767. He is also called "the ascetic Ratnagupta n • Despite his second Indian name, which actually only is a translation from the Tibetan, there is no reason to believe that he was not a Tibetan. As will be shown in the figures below (p.54-55), sOom-pa was one of the main lineage holders of the 'Bro school 179 "Silk scarf' here means the traditional white Kha-btags which is used as a sign of honoring someone all over Tibet. The Tibetan word used here is dar-yug. Dar = silk and according to Iiischke honorific language for Kha-btags. lB. Probably here is meant that he made prostrations before Somaniitha. IB' Tib. mNgon-pa, Abhidhanna, the third part of the Buddhist canon. IB2 Sa = skt. bhami, earth, degree. sDe = part, class. In the Tibetan tradition Sa-sde stands for the the five works by Asanga in the bsTan- 'gyur on Yogiiciirabhami; Toh. 4038-4042, P. 5539-5543. IB' This means that sOom-pa received the texts and doctrines of Kiilacakra. He was now considered to have enough qualifications to receive these teachings, considered very advanced and exclusive. IB4 He is also' called rTsang-ston (p.64:4). sOro is also mentioned by 'Oos lo-tsa-ba (Roerich. 1949/53:755,766-767) as sOro-ston. He reached at least the age of 72 (see this text below p.64:4).He was asked by Somaniitha to carry his belongings to Mang-yul (Ladakh) when going back to India. In that way sOro would receive the teachings, but he refused and eventually he received the teachings of Kiilacakra anyway and became one of the main lineage holders in the 'Bro school of Kiilacakra. I have not found sNor-bzang on maps. There is also mentic,lO of an earlier sOro-ston of the rNying-ma-pa school who built a temple at sOro-phug (Roerich. 1949/53: 113). '85 Phul = a unit of measure equal to one-fourth of a bre. Bre = volume measure for solids. 20 bre = 1 khal. . Khal = a standard measure of volume equal to about 25-30 pounds. Although these are modern values they can give a hint alto how much it was at the time of the text. (Goldstein. 1983:710,773,129)

37

[Then] Lo-ro-ba said: "There is someone by the name mChims, 187a great tantric, he is like someone who carnes a rdo_rje. 1881 was like an ox. Now, because 1 met the three Leng, 'Brog and 'Gos,189 1 am also like someone who carries a rdo-rje." Because he [Loro-ba] said: "But if someone appears [who has] knowledge of Kiilacakra, 1 will be like an OX".190 gNam-brtsegs aroused great faith in the bla-ma [Lo-ro-ba], and he [gNam-brtsegs] gave twelve golden srang and a black horse to the PalJrjita ISomanatha}. (p.62:3) Even by serving [Somaniitha] for a long time, he [gNam-brtsegs] was not given anything besides the rules of conduct. 191 At the time of that [event], [gNam-brtsegs] after having given a thin bit of gold to bLa-ma dKon-mchog-srung, even [when] requesting he was not granted [the teachings]. (p.62:4) While the PalJrjita went away to India, in the meantime, he [gNam-brtsegs] was raised to a [higher] position for three years, and because he requested, [dKon-mchog-

186 'Gas Lo-tsa-ba mentions that Lo-ro-ba propagated a teaching named bZhi-chos ("the four dharmas") (Roerich. 1949/53:948). dGe-pa shes Lo-ro-ba means "the dGe-shes from Lo-ro, which is a place in the region Lho-ka in the south-eastern part of central Tibet near Bhutan.(Wylie. 1962: 174; Ferrari. 1957: 126). As is commented on by Wylie, Lo-ro-ba could also be the name of Ras-chung-pa (1083-1161), the famous disciple of Mi-Ia-ras-pa, but his dating makes that impossible as these events must have taken place in the 1060s or 70s. sBu-sde as a place name is not identified. 187 There is another mChims mentioned later in the text (p.72:I), but he lived in the 13th century (see note 368). mChims is an old aristocratic family in Tibet and also a name of a village near the monastery of bSamyas (Das. 1903:434). A minister under king Khri-srong Ide-blsan was from this family. According to 'Gos 10tsa-ba the farnily'Chims changed its name to Zhang some time before the II th century so perhaps there is a connection with the Zhang-ston that invited Somanatha (Roerich. 1949153:95). The place is also called mChims-phu and has a place in Tibetan history connected with Padmasambhava and the rNying-ma-pa school (Dowman. 1988:231-232). As the spelling in Tibetan is difficult it could also be spelled 'Chims and there is also a bla-ma 'Chims mentioned, but he is a little late in time (Roerich. 1949153 :406) so which mChims is meant in this text remains unclear. 188 skt. vajra. Possibly just another way of saying that he was a lantric using the ritual instrument vajra. 189 These three were famous translators in the 11th century. They are mentioned together as the three great disciples of a bl-ma gZhus (Roerich. 1949/53:72). There is not much information to be found about gZhus. rNgog Lo-tsa-ba (1059-1109) is mentioned as having studied with one of gZhus's disciples so he must have been active earlier in the 1I1h century (Roerich. 1949/53:325). There is a region of gZhu in a valley north of the Tsang-po river in the western part of the dBus province where he could have his origin (Ferrari. 1958:69,161). Leng lo-tsa-ba came from La-stod in upper gTsang and lived in the later part of the 1I1h century.(Roerich. 1949153:852). 'Brog is probably to be identified with the founder of the Sa-skya-pa school, 'Brog-mi lo-tsa-ba sakya gzhon-nu (992-1064/72).(Roerich. 1949/53:205-210). He was reported to have worked with 'Gos lo-tsa-ba. 'Gos-Io-tsa-ba was probably a 'Gas Lhas-btsas living in the IIIh century.(Roerich. 1949/53:359-366) He is described as the main introducer of Guhyasamaja Tantra to Tibet. He had his residence in Zur-pa. Zur was an old family connected with the rNying-ma-pa with its residence near gZhis-ka-rtse in gTsang (Wylie. 1962:61,144). He is not to be confused with the 'Gos Lo-tsa-ba gZhon-nudpal who wrote The Blue Annals in the 15 th century. He received teachings from 'Brog-mic It is noteworthy that the Buddhist masters in the dynamic IIIh century in Tibet were not limited to their own schqols, which, in any case were not yet founded. They searched teachings from many different teachers from various Buddhist traditions. 'Gos Ihas-btsas also worked with translations with for example the Indian pandit Gayadhara (Toh.1I96). 190 This last passage is not easy to understand. It could be understood as a recommendation from Lo-ro-ba to sGro to go to Somanatha in order to get the Kalacakra teaching. 191 Again it is stressed how difficult it was to obtain the Kalacakra teachings. sGro had to possess great merit. One can compare with sGom-pa who received the teachings for six golden srang.

38

srung] gave all basic texts and the manuals [of Kalacakra to gNam-brtsegs].I92 As the Pandita later arrived in Tibet, all the disciples [said] that sGam-pa granted sGra the manuals' ~ompletely because he [[[sGra]]] requested [them]. And as the PalJt;iita said to sGra: "I [wanted ]to give [you] the precepts." [[[sGra]] answered:] (p.62:5) "[You] did not wish to give

[them to me] at the time of my youth, but now since I am old I don't want to ask [for them]." [And the Pa1,lt;iita said:] "You are satisfied with the precepts of dKan-mchagsrung' [And] after that [Samanatha] had said: "If that [[[teaching]]] did not come from me, from whom did it originate?", he [Samanatha] hit him [[[sGra]]] with the hand. [And sGra said:] "That is true. It has been made to exist by the kindness of the great bLa-ma [Samanathal" (p.62:6) As he [Samanatha] said: "What did he [dKan-mchag-srung] give to you?" [[[sGra]]] said accusingly: "He gave me these [teachings]." [Then sGra], after having said: "He didn't give me more than these [teachings], [now] because [you] have all the complete [teachings], do not give [them] to anyone. You should swear not to give [them]." He put a rosary around the neck [of sGra] and [[[sGra]] said:] (p.62:7) "Because [you] the bLa-ma did not give [the teachings], I of course asked bLa-ma dKan-mchag-srung." Then [Samaniitha], after having said:"This is a bad person," threw sand at the head [of sGra]. [And] as [[[Somanatha]]] said: "Now, do not destroy [the teachings]," [[[sGra]]] said: "That, you should not say. Why should it be destroyed?" Thus he [[[sGra]]] listened to the Pandita and dKon-mchog-srung [give] the basic texts together with all the instruction •. 193 manuals. (p.63:1) After that, someone called rNgam-khram-pa dad-po rgyal_pa l94 was born near the snowy Kailas/ 95 and among [his] four sons, the small one bLa-ma Yu_mo l96 listened to the dharma teachings in the presence of Se-ston sgra-gcan- 'dzin from Dan-ma-ri 197 and Bar-stan Thas-pa-dga' .198 (p.63:2) By him [Thas-pa-dga 1 he was given the name

\92 sGom-pa seems to have been the chief disciple of Somani'itha as he was left with the responsibility of the monastery when Somaniitha travelled to India. 193 The whole of this short story of how sGro eventually received the blessings of the reluctant Somanatha to practice the Kiilacakra teachings shows the harshness of tantric relations between master and disciple. Somaniilha hit him with his hand and threw sand at his head. The importance is the result that sGro eventually became a master himself. 194 Not identified. 195 Tib. Ti-se. The father of Yu-mo came from the far west of Tibet, the province mNga '-ris where the holy mountain Kailas is situated. This region has traditionally always had independent relations with neighbouring India and Kasmir. Therefore, it is possible that Yu-mo, and consequently the Jo-nang-pa school was independently influenced from India. 196 Yu-mo Mi-skyod-rdo-rje is the person to whom is devoted more space is devoted in Bu-slon's text than all others except for rGa-Io and Somaniitha. He is the ideological father of the Jo-nang-pa school and the "substantialistic" doctrine of gzhan-stong. Yu-mo lived in the latter half of the II th century and the beginning ofthe 12th. See (Ruegg. 1963:77,82-83; Roerich. 1949/53:179,186,636,755,767-68; Andresen. 1997:173,178 and Hookham. 1991 :59-60, 135). There is the possibility of an independant influence from India on the gZhan-slong doctrine because of the origin of Yu-mo in the region of Kailas in western Tibet. This has always been the goal of many Indian pilgrims (Ruegg. 1963:77). Recently Steams has investigated Yu-mo's role in connection with these teachings. He claims that, from reading Yu-mo's own work gSal sgron skor bzhi (Four clear lamps), Yu-mo did not formulate the gzhan-slong doctrine clearly. This was the work of Dol-po-pa. The claim that Yu-mo was the origin of the gzhan-stong . teachings stems mainiy from Tiiraniitha. 1983: 16. Steams. 1999:44-45, 199-200 n.1 O. 197 Roerich. 1949/53:857. He was a disciple of the Indian scholar Vajrapi'ilJi in the Mahiimudra tradition. He

39

Yu-mo. He [Yu-mo] listened to the dBu"ma l99 and the Tshad_ma 200 at gNyag from rMa dge-mthong. 201 At that time [one] considered that there was no greater 'Dul-ba~teacher202 than Sog.z03 Therefore he [Yu-mo] went there and [Sog] explained by heart the mDo_rtsa. 204 He [Yu-mo] even learned the doctrine of sPyod-phyogS.z°5 (p.63:3) Because he wanted the tantras, he learned the tantras like Hevajra 206 and"others. Meanwhile, because he [Yu-moJ was asked by a friend: "What are you doing in the winter?" [Yu-mo] said:"While in a retreat, I will be writing a book on tantra." [And the friend] said: "Well then, at Byan-klag-chanio7 there is the commentary made by rDo-rje snying_po,208 [and I] heard [somebody] say: 'Do you want to write [a copy] ?'" (p.63:4)

came from Don-rno-ri which, at least in the 12"' century, was a famous monastery in the gTsang province. Vajrapi'ilJi lived in the second half of the 11"' century. When Se-ston was his disciple he was staying at Chusgo in gTsang. (Roerich. 1949153:82,1013,1039). The Se family belonged to the old aristocracy from the time ofthe dharma kings of Tibet (600-842), (Roerich. 1976:37). 198 Could this possibly be Mi-la ras-pa, whose personal name was Thos-pa-dga'. 199 Skt. Mi'idhyarnika. Here is probably not meant a special text but the whole philosophical system. 200 Skt. prarni'ilJa, usually translated as Buddhist "logic". There are many texts belonging to this system. 201 rMa was an old and well-mown family. There was a rMa Rin-chen-rnchog mown already in the 8th century (Ferrari. 1958:65,152). He was one of Padrnasarnbhava's 24 disciples and obviously one of the founders of the rNying-rna-pa school.(Dowman. 1988:230,279). The rMa in this text could be the rMa born in 1055 who was a disciple of the Indian master Darn-pa Sangs-rgyas, a tradition holder of the Mahi'irnudra and active in the Yar-klung valley where there is a place called gNyags, also the site of the old family of gNyags. rMa also met a gNyags lo-tsa-ba who presumably was the mown abbot of the bKa'-gdarns-pa establishment sTag-spyan burn-pa (II"' century) (Dowman. 1988:183-184; Roerich. 1949153:170,872-875). In the 11th century it was a good choice to go to a monastery of the school of Atisa because there the knowledge of these subjects would be the best. 202 Skt. Vini'iya. 203 Sog, whose complete name was Sog Dulba 'dzin-pa or Sog-po rnDo-sde is mentioned as a great Vini'iyateacher who was active in the I I"' century. The Vini'iyadhara of rGya ,who was born in 1047 studied with Sag, so he must have been somewhat older (Roerich. 1949153:78). On the other hand, one can find that 'Gas lo-tsa-ba later in the same text states that Sag only became 36 years old and still was the teacher of a person born in 1091 (Roerich. 1949153:80). In that case Sag must have died some time around I I 10 and been born around 1075. It is therefore difficult to understand how he could be the teacher of someone born in 1047. These are consequences that arise from the fact that for many of the dates for these old masters there are very few sources. Later Tibetan historiographers often do nothing but repeat the dates given by earlier ones like BlI-ston and 'Gas lo-tsa-ba gZhon-nu-dpal. The latter also mentions that Sog was the disciple of the father of the above mentioned rMa, but also of Darn-pa rMa, which clearly makes invalid the indication that Sag could be born as late as in the 1070s (Roerich. 1949/53:874). The conclusion must be that he was born well before 1050. 204 This is the Vini'iya-text 'Dul-ba 'i rndo, skt. Vini'iya-sutra, in the bsTan- 'gyllr TohA117. 205 This could be a misspelling of the word spyod-jugs. In that case, the text is the Bodhisattvaci'iryi'ivati'ira by Shantideva (Roerich. 1949153:611). It is probably a misspelling because this is a basic textfor all students of Buddhism in India and Tibet and it is translated into many modem languages. It is a Mahi'iyi'ina classic about the way to act in order to reach the state of a bodhisattva. It could also be that spyod-phyogs refers to advances tantric practice in general. " 206 Tib. dGyes-rdor which is short for dGyes-pa rdo-rje. Here must be meant the whole tantric system as is customary when mentioning tantras. The main text is Hevajratantra-ri'ija-ni'irna, TohA17. Translated in Snellgrove. 1959. A later translation also exists. 207 Unidentified. 208 Skt. Vajragarbha. He was an Indian tantric who wrote a famous commentary on the Hevajratantra,

40

Therefore, because [that] aroused [his] fonner inc1inations,209 he [Yu-mo] was very contented. And because he asked: "Can you acquire this book?", he acquired it. Examining closely that book, he came to have great faith in it. And to the question [from Yu-mo]: "Who knows about it?", [the friend] answered: "It is known by Somanatha." After having thought: "That is the previous name ," he [Yu-mo] went to dBui lO where he settled down. While listening to the sPyod_phyogs211 from Khams-pa lte 'u-ba,212 he heard that it was said: "Pa1pjita Somanatha stays at dKar-chung.,,213 (p.63:5) As he [Yu-mo] asked: "Does he [[[Somanatha]]] know what rDo-rje snying-po knows?" [Khams-pa lte 'u-ba] answered: "Yes, he knows that [ doctrine], and further, he knows even The Great Commentary of Sr, Kalacakra.,,214 When questioned [by Yu-mo]: "If asked, will he [[[Somanatha]]] give the doctrine?" (p.63 :6) [Khams-pa lte 'u-ba?] answered: "Generally [his teaching] is very secret. But because he does not have anyone to serve him [when he wants] to go to N epa!, if you are able to go [there to serve him], he will give [the teachings to you]." The Par;cjita and gNam-la brtsegs stayed doing a revision of the hundred-letter root-mantra of Hevajra. 215 (p.63:7) Then Dus-gsum-pa rDo-rje gzhon-nu,216 after having acted as intennediary,217 made the request [and] after having shown much precious musk and a lot of gold, he [Yuma] was told [by Somanatha] through Dus-gsum-pa: "You shall carry these [things] , and [if] at the time when you arrive to Nepal you still have everything [in good care], then he [[[Somanatha]]] will come from Tibet and give the dharma [to yoUj.,,218

Toh.1180, Hevajra-pit:u;iartha-tfkii, translated to Tibetan by Diina.ffla (Lessing & Wayman. 1968:256257,263). This text is part of the so-called Bodhisattva Corpus and was transmitted at the same time as the two other texts on Kiilacakra and Cakrasamvara that comprise the Corpus. (Newman. 1987:77,111). Later in the text it is stated that Somaniitha also lmew the Great Commentary of Kiilacakra, so a connection has been shown. The connection with the Kiilacakra texts is also made by 'Gas lo-tsa-ba gZhon-nu-dpal (Roerich. 1949/53: 830,83 8). 20. Tib. sngon-gyi bag-chags, slet. viisanii, "karmic imprints". The word is used to indicate the influence of actions in former lives on that person in this life, so Yu-mo presumably lmew about the book in a former life. 210 Traditional Tibet is comprised of five regions. mNga '-ris in the west, gTsang and dBus in the centre, Amdo in the north-east and Khams in the east. 211 See note 205. 212 Unidentified. His name only indicates that he came from Khams. 213 Ferrari. 1958:47,119. DKar-chung is a very small place to the east of bSam-yas near the river Tsang-po. This is further away from Lhasa than he was said to have stayed earlier in the text. Monks and lamas travelled around frequently at this time searching for teachings in different monasteries, or, as Somaniitha, teaching himself. 214 Tib. dpal dus-kyi 'khor-lo'i-grel-pa chen-mo. This is the Vimalaprablzii commentary commonly refered to as the Great Commentary. 215 There exist very long mantras. This one is of the Hevajra tradition. 216 Unidentified. In this case he represents the tradition that there was need for an intermediary to approach an important bla-ma such as Somaniitha. 217 Tib. Zhu-sna byed-pa, "to act as intermediary". This is a special expression in Tibetan to say that somebody is advocating another persons interest on behalf of someone else. 21. This is another example of the degree of sacrifice that was needed in order to get some special tantric teaching. Yu-mo had to carry his teachers' things to Nepal from dKar-chung which was quite far away. He would then receive the teachings there instead of getting them at once.

41

(p.64:1) Then he [Yu-mo] anived to obtain a book from sGom-pa Tshul-khrims gragi 19 and he [sGom-pa] said:"To where do you go?" He [sGom-pa] requested the fomler story and said:"Y ou will not get the dharma from the Pal}qita. Many who came before did not get it." And [sGom-pa] said:"Therefore, my bfa-rna lives in sNor-bzanl20 and knows completely the dharma of the Pal}qita." Because ofthat, he [Yu-mo] changed his mind. (p.64:2)sGom-pa dBang-gsod22 1 and sTon-pa rgyal-pa 'od 222and sGom-pa Tshulgrags 223 acted as intermediaries [between Yu-mo and sGro gNam-la brtsegs]. Because he [Yu-mo] gave as an introduction gift some golden zho 224 and one beautiful dung-chos 225 and one Ka_pa_la 226 [to gNam-la brtsegs] , he[gNam-la brtsegs] said:"You have quite a good relation to these [sGom-pa and sTon-pa]. (p.64:3) This monk Sog 'Dul-ba 'dzinpa,227 gives dharma verbally28 to everybody who doesn't know how to eat and doesn't know how to put on his clothes, acting like a father. You are the one who is attached to the heart of these [[[teachers]]]. Therefore you must have some qualities."After having come to say [that], he [gNam-la brtsegs] promised to give the dharma [to Yu-mo].(p.64:4) The blarna [gNam-la brtsegs], at the age of seventy-two, was met [by Yu-mo] who stayed there continuously for four years,z29 He [Yu-mo] listened to the explanations and instructions of the Kalacakra 230 and mTshan-brjod23 I and the sGron-gsal 232 and others. After having imagined [that] a disturbance of the dharma [could come], and after having prayed to the mKha'- 'gro_ma: 233 "Don't kill me until I have finished the dharma of this rTsang-ston,234 even if I am slightly ill," he [Yu-mo] was given all the doctrines [of Kalacakra from gNambrtsegs]. (p.64:S) And [Yu-mo], after having stayed [there] between fifty and eighty years of age, because he talked [about the dharma], he increased the spread [of the doctrine of Kalacakra] .235 219 There is a sGom-pa Tshul-khrims mentioned who was a disciple of Nag lo-tsa-ba (b. I 0 10) and consequently active in the second half of the II th century. 220 sGro gNam-la brlsegs. 221 Unidentified. 222 Unidentified. 223 See note 219. As he was the disciple of sGro, he acted as intennediary for Yu-mo. 224 10 zho = I srang. It was a quite small sum. 225 A conch-shell trumpet for use in the ritual. 226 Skt. Kapiila. It is a bowl made out of a skull, used in tantric rituals. 227 Sog Viniiyadhiira. See note 205. 228 Tib. Zhal-chos, "mouth-dharma". 229 The advanced age of sGro gNam-la-brtsegs shows that this must have taken place quite late in the II th century. 230 Here should be meant the laghutantra (KCT) and the Vimalaprabhii commentary. 231 Toh.360, bKa'-'gyur, rGyud-'bum. Tib. 'Jarn-dpal ye-shes-sems-dpa'i don-darn-pa'i m/shan yang-dagpar brjod-pa. Skt. Mafijusrijfiiillasattvasya paramiirthaniimasaizgiti. 231 This is short for one of several texts with sGron-gsa! in the title. It is probably Toh. 1785, Pradfpoddyotana of Candraklrti. , 23J "Sky-wanderers". Skt. (iiiki1}l. They are a sort of female deities roaming about in the sky. They can be . . good or hostile. 234 "The master from rTsang." This must be another designation for sGro sNam-la brtsegs from sNor-bzang. He also came from a place called rTsang. The bnly reference to rTsang is found in Roerich. 1949153:916 where it appears to be a place in the north ofthe gTsang province. 235 Here one can see the importance of Yu-mo because he stayed for thirty years spreading the Kiilacakra. Probably in sNor-bzang because it was there he stayed to meet sGro gNam-!a-brtsegs.

42

When he [Yu-mo] was fifty-five years, his son Dharmesvara 236 was made a disciple at a young age because of former inclinations.(p.64:6i 37 From the age of twelve he [DharmeSvara] taught the doctrine of SekkodeSa 238 and from sixteen he taught the Great commentary,239 and as for other texts, he was studying the sPyod-phyogi 40 and the Lamrim241 and many tantric sadhanai 42 until the age of thirty (p.64:7). [And] he produced very great benefit even to others. . His [DharmeSvara's] disciple Nam-mkha'- 'oJ243 listened to the Rigs-tshogs 244 and so forth of 'GosdBang-pa-can. 245 And he [[[Nam-mkha]] '- 'od] listened to bLa-ma DharmeSvara give many explanations of the root-text and the manuals of the Great Commentary of Kalacakra. 246

(p.65:1) The son [of Yu-mo], DharmeSvara's son, Siddha Nam-mkha' rgyalmtshan 247 listened to all the texts together with the precepts of Hevajra and Kalacakra and so forth [from Nam-mkha'- 'od]. From him [[[Nam-mkha']] rgyal-mtshan] 'Jam_gsar248 obtained full control of Phartshad_mngon 249 and so forth, and he asked for the empowerment at the monastery in the He was also a master of the Jo-nang-pa school (Ruegg. 1963:80). His daughter Jo- 'bum was married to the rNying-ma-pa master Nyi-ma 'od-zer (1136-1204) and was considered an incarnation of Ye-shes mlshorgyal, the spouse of Padmasambhava. She was also a practitioner of the Kalacakra. It follows that Dharmeivara must have been born around 1085 because he was at least ten when Yu-mo was 55, around 1095 (see below, p.64:6-7). Consequently, there is here a clear connection with the old rNying-ma-pa school (Dargyay. 1977:100,214 note 56 and Meisezahl. 1985:10,15 and Roerich. 1949/53:768). 237 Consequently, he must have been a reincarnation of a fanner Kalacakra master. That was why he could learn everything so fast. 238 Tib. dBang-mdor bSlan-pa. In bKa'- 'gyur Toh.361, 7 foL Translated by Somanatha and 'Bra Shes-rabgrags. It is one of only five texts on the Kalacakra in the rGyud- 'bum section of the bKa '- 'gyur. The text is considered to be a portion of the lost root (mula)lantra and treats the Kalacakra inititation. It has recently been edited in a critical edition (Orofino. 1994). The well-known commentary by Naropa, the Sekodde.fa!ika, has also recently been edited and translated into Italian (Orofino &Gnoli. 1995 and Carelli. 1941). '" The VimalQprabha. 240 See note 197. 241 This should, at that time, before Tsong-kha-pa, be the text Bodhipatapradipa by Aliia, Toh.3947. It could also be another lam-rim. . 242 Tib. sgrub-Ihabs "method". The name for the lantric method of evoking and visualizing the tanlric deities and making a ritual perfonnance. 243 'Gro-mgon Nam-mkha '- 'od-zer was, according to Dud-jams Rinpoche, the son of Dharmeivara.(Dargyay. 1977:100). Here he is a disciple. 244 Rig-Ishogs (drug), skt. [~a41-yuktisiistra, "the collection of the six treatises." Six treatises on the Mtidhyamika by Nagarjuna. (Ruegg. 1963) (Rigzin. 1986:398.) 245 Unidentified, although 'Gos is a well-known family with famous translators like 'Gos lo-tsa-ba Khug-pa lhas-blsas (11 th century) and 'Gos lo-tsa-ba gZhon-nu-dpal (15 th century). 246 That is, the complete Kalacakra tradition. 247 Also called Siddha Se-mo che-ba (or Se-chen) Nam-mkha' rgyal-mtshan (Ruegg. 1963:80; Roerich. 1949153:755-56,768-71). He is said to have practised the ~at;langa-yoga and "the six doctrines of Naropa". He was called Se-mo che-ba after his place of residence Se-mo-che in the gTsang province near the river gTsang-po. 248 Or 'Jam-dbyangs gsar-ma Shes-rab 'od-zer. (Deb ther sngon po tha 2b,8b; cha 4b-5a; ta 2a; Roerich. 1949/53:756,769-71,335-36,727,1052.) According to Ruegg, itis said in the Grub mtha' shel gyi me long by Thu 'u bkvan Blo bzang chos kyi nyi rna that until then the Kalacakra scripture was limited in its diffusion, but . after 'Jam-gsar the teaching became generalized (Ruegg. 1963:80). 'Jam-gsar founded a school at sKyang'dur and had among others Kun-mkhyen Chos-sku 'od-zer as a disciple. The latter was also the Sllccesor of 236

43

small village gYas-ru sMon-mkhar250 and he ['Jam-gsar] learned all the tantra commentaries and [the corresponding] parts of the instructions. (p.6S:2) From him ['Jam-gsar] bLarna rGa_Io 251 learned [the doctrine]. . 2. [The History of the Rva school]. Rva lo-tsa-ba Chos-rab/ 52 the nephew of Rva lo-tsa-ba rDo-rje grags,253 was born in the country of sNye-gnarn-snang?54 After having put into his mind all the dharma divisions of 'Jam-gsa,. in the 'Bra tradition according to 'Gas la-tsa-ba.(Roerich. 1949153:755-56,770). Perhaps because of that Bu-stan ends his description of the 'Bra school with rGa-la, Chas-sku 'ad-zer is not mentioned by him. There is also another reason: Chas-sku 'ad-zer was the next tradition holder of the Ja-nang-pa school, which was not appreciated by Bu-stan.(Ruegg. 1963:80). 249 Short for Phar-phyin, s!ct. Prqjiiiipiiramitii, Tshad-ma skt. pramiil}a ("logic") and mNgan which is the Abhidhanna system. 250 gYas-ru is one of the two provinces into which gTsang anciently was divided. Literally, it means "the right hand division" (eastern gTsang), the other province being gYan-ru "the left side division".(western gTsang) . .(Das. 1902) There is a Man-mkhar dzang in the east of gTsang not far from the monastery of mTshur-phu.(Ferrari. 1958:161, note 621.) 251 For rGa-la, see the chapter on the Rva school. It can only be remarked here that Bu-stan ends the story about the 'Bra school with rGa-la. The reason probably being that the two schools 'Bra and Rva were united in his person and also perhaps because the following masters of the 'Bra school were all also masters of the Ja-nang-pa and close to the time of Bu-stan himself and his doctrinal conflicts with Dal-pa-pa and the Janang-pas. 252 He lived in the second half of the I I th century and the first half of the 12th. His birth date is given by Macdonald as 1070 and he should have supervised the reconstruction work of bSam-yas in I 106 (Macdonald. 1970:181). He is not so well known as his uncle, but more information can be found about him (Roerich. 1949/53:378,755,756,789,837). He was a specialist on the Yamiintaka tantric cycle. He was very active in general in purchasing and translating texts from India. He translated two texts together with Saman/airi , Toh.365 Sekaprakriyii and Toh. I 374 :ja4angayagapade.fa and also six small texts together with Viigi§vara (gupta), tib. Ngag-gi dbang-phyug or Thang-chung-pa. (Toh.l358-59,1362,1392-94). The latter is by 'Gas la-tsa-ba identified with the youngest brother of a Nepalese known as Pham-mthing-pa or A-nges-pa chenpo. This Than-chung-pa went to India and stayed receiving teachings from, among others, Nii-ra-pa. The fact that he was a Nepalese explains his translation work with Rva Chas-rab. Pham-mthing-pa had another younger brother called Dus- 'khar-ba (s!ct. Kiilacakra) who studied directly with Niiropa and from his name one can deduce that he learnt the Kiilacakra. A third brother was Badhibhadra (tib. Byang-chub bzang-pa), disciple of Nii-ra-pa, who could be the same as the Bhadrabadhi working with Gyi-ja and also a teacher of Atiia.(Roerich. 1949/53:381-84). A complication in this context is that Pham-mthing-pa is called Viigi§varakirti but it is not probable that it was he who translated texts with Rva Chas-rab (Roerich. 1949/53:226, Wylie. 1962:200). This should explain the Nepalese origin of two of the great translators working with Kiilacakra in Tibet. The conclusion of the foregoing is that it confirms that Samantasri and Rva Chas-rab were active in working with Kiilacakra translations in the second half of the 1I th century, although closer to the last quarter. 253 A short biography can be found in Roerich. 1949/53:374-380 and there exists a special rnam-thar (Rwa-la rNam-thar 1974 and 1965). His birth is given as 1016 from his rnam-thar (Bod rgya mtshig mdzQd chen mo. 1985: 3214) and his death is given by Macdonald, also from his rnam-thar, as the year 1114/16. This means that he should have reached the age of 100 years, something that is not very probable. There are some problems with the dates of the rnam-thar and probably his birth date is more reliable than the dating of his death. See also Ferrari 1958:42,98,105. He was famous as a translator and as the main introducer of the Yamantaka tantric cycle to Tibet. It is known that he attended the council (chas- 'khar) organized by king rTse-lde in 1076 and directly after the council he and gNyan La-tsa-ba Dharma-grogs went directly to Nepal and India in order to get teachings from there. (Roerich. 1949/53:70-71). There is no mention by 'Gas La-tsa-ba that

44

the Rva_pa 255 the three divisions of Nag- 'jigs 256 0f the Rva tradition, and the mNgon'byung rnam-gsum,257 (p.65 .3) [and] the tantras of Abhidhana 258 and Sampu!a 259 and so north, and 261the siX: Chos- 'byunl 60 and so forth, he [[[Rva]] Chos-rab] turned to the Kiilacakra. After having arrived to central Nepal,262 (p.65:4) and after having adhered to Pm:z4ita Samantasri 263 for five years, ten months and five days, because he [[[Rva]] Chos-rab] reRva Chos-rab also went there with him, but it is possible, and in accordance with the timing, that Chos-rab went with his uncle to Nepal and there separated from him and went to see Samantasrf and invited him to Tibet. As is written later in this text by Bu-ston (p.65:4), Rva Chos-rab was supposed to have stayed in Nepal for five years and then invited him to Tibet. If he went to Nepal in 1076, Samantasrf arrived in Tibet some time around 1082. Another possibility is that the school of Rva lo-tsa-ba rDo-rje-grags was formed after his visit to India and Nepal, as can be deduced from information about him (Roerich. 1949/53:375). Rva Chosrab learned from his school before going to Nepal looking for Kalacakra. There is no mention that Rva rDorje-grags ever learned or taught the Kalacakra Tantra. The conclusion is that Rva Chos-rab went to Nepal considerably later, in the 1080s or 90s. 254 Also Nye-lam, Nya-lam, gNya'-nang or Kuti (Wylie. 1962:65,129; Wylie. 1970:49; Ferrari. 1958:98). This was also the birth-place of Rva rDo-rje-grags (Roerich. 1949/53:374, Wylie. 1962:65,130)) and the family seems to have been firmly established at this site. I have not been able to find the name sNye-gnam-snang on available maps (Verhufen. 1995, Dowman. 1988:267, Batchelor. 1987:343, Wylie. 1962, Ferrari. 1958: map and ONC H-9), but the name of the place, if not the actual monastery, could be Nye-lam or (in modem maps) _ gNya'-lam, which is located almost at the Nepalese border on the main road between Katmandu and Lhasa. As one can deduce that this was a main communication line even before the advent of modem roads, it is not strange that both Rva Lo-tsa-ba 's went to Nepal (i.e. Kathmandu) to study Buddhism, as it was the centre of the then f10rishing Newar Buddhism. Communications were also relatively good with central Tibet. 255 The name of the school founded by Rva rDo-rje-grags which mainly propagated the Yamantaka tantric cycle. (Roerich. 1949/53:374-79). He did not teach the Kalacakra. "6 This is probably the black Yamantaka normally called gShin-rje in Tibetan. As Rva rDo-rje-grags was a leading expert on that cycle, it is the most probable identification. It could also be K(e1}a-Yamari, RaktaYamari or Vajrabhairava. 251 This is probably a text in the Caryatantra system, the basic text of Vajravarahf is Toh.377. It should be noted that the following two texts on the same tantric cycle (Toh. I 78-79) were translated by Gyi-jo Zla-ba'i 'od-zer and Gayadhara and consequently, there is a connection with the Kalacakra. It could also be the Herukabhyudaya (Toh.374), Samvarodaya (Toh.373) or Abhidhanoltara (Toh.369) (communication from Newman june-04). 258 Toh.369 is the basic text of Abhidana Tantra. '" Toh.381 is the basic text of the Sampu{a Tantra. 260 Unidentified. 261 It should be noted that Rva Chos-rab first studied all these other teachings before studying the Kalacakra, which consequently can be regarded as the most important "highest" teaching. 262 Tib. Bal-po 'j mfhil-du, "the Kathmandu valley". 26, Newman gives the Indian beginning of the Rva school as follows: An emanation of Maiijusrfi or Avalokite.ivara - Cilu - Pi1J4o - Kalacakrapada the Elder - Kalacakrapada the Younger (Bodhipa, Nalendra-pa) - Maiijukfrti - Samantasrfbhadra - Rwa Chos-rab.(Newman. 1987:94). The 'Bra school also derives from Kalacakrapada the Elder who, according to Newman, was the same as Pi1}r;io. (Newman. 1987a: I 06). This is refuted by Orofino, who rightly doubts that we have enough information to draw that conclusion (Orofino. 1994:20). Samantasrfprobably lived in the late II th and the first part of the 12th century. He was probably a Newar Buddhist living in Kathmandu (or Palan; lib.Ye-rang) as Rva Chos-rab is said to have stayed five years there with him. Samantasrf must have been to Magadha and the monasteries of Nalanda and Vikramasila in order to study the Kalacakra. The two schools separated, the Rva tradition continuing in the Kathmandu valley and the 'Bra tradition in Kashmir.

45

quested the explanation [and] the empowerment together with the instructions, he was given everything [by SamantasrJ].264 (p.65:5) After having invited the Par;ejita to Tibet, he [[[Rva]] Chos-rab] explained the tantra commentary together with the branches. 265 'He translated and systematized, [and] he was held in great veneration by everybody. One day he [[[Rva]] Chos-rab] gave 300 golden sranl 66 [to SamantasrJ] and accompanied him on departing [for Nepal] even up to sKyi_rong. 267 (p.65:6) So the bLa-ma was very pleased and he donated the tiara of the Par;ejita 'Bum-phrag gsum-pa, 268 sandals [and] a rdo_rje269 and a dril_bu 270 according to the measures of Kiilacakra. 271 His [[[Rva]] Chos-rab] own son, bLa-ma Ye-shes seng-ge272 was learning [from him] everything, [and] knowing it by h~art, he practised it. (p.65:7) His EYe-shes seng-ge] own son Rva 'Bum-seng,m learning everything, practised it. From him bla-ma rGa_Io 274 has taken [the teachings of Kiilacakra]. As for bla-ma rGa-lo, at the time of the kings of Tibet, the rninister bZhang-shP75 was sent as envoy to

264 This clearly shows a strong connection with Nepal concerning the Rva tradition. The same is the case with Kashmir concerning the 'Bra tradition. Consequently, there are two traditions with distinct geographical origin, which also indicates some difference in the teachings. 265 By the tantra commentary, here is probably meant the Vimalaprabhii. The "branches, limbs or auxiliary texts" could mean that Samantasrl and Rva were teaching the ~aq.angayoga something which is confirmed by the fact that the two translated an instruction text on the ~a4angayoga in the bsTan-'gyur (Toh.1374, Saq.angayogopadesa by Cilupa.). 266 This is the largest sum mentioned in the text. It can be deduced that it was a sort of fare-well gift for Samantasrl after him having stayed in Tibet teaching for some time. The Rva family was also very wealthy. For example, Rva lo-tsa-ba rdo-rye-grags paid one thousand golden srang to another Nepalese master and also rebuilt the main temple at bSam-yas (Roerich. 1949153:378). 267 Or sKyid-grong. A village and a district close to the Nepalese border on one of the main routes from Kathmandu to the province of gTsang.(Wylie. 1962: 172, Ferrari. 1958: 154). 268 rNgog lo-chen-po or rNgog bLo-ldan shes-rab (1059-1109) was a disciple of 'Bum-phrag (or brTanskyong = Sthlrapiila) which means that the later lived a little before that time (Roerich. 1949153:325). Sthlrapiila got his title 'Bum-phrag gsum-pa (=300.000) because he had memorized 300.000 Slokas (Roerich. 1949153:789). Siddha Nyin-phug-pa (1094-1186) studied with 'Bum-phrag at Bo-dong when he was 14, that is, in the year of 1108 (Roerich. 1949/53: I 009). The fore-going shows that Saman/asrl must have lived in a period quite late in the 11th century and the first half of the 12th, because it is quite evident that he was a disciple of 'Bum-phrag as he possessed the hat. 269 Skt. vajra ("diamond"), a ritual instrument. 270 Skt. ghal!!a (bell). An instrument used in the ritual. 271 There exist traditions of special measures for these ritual instruments in the Kiilacakra Tan/ra. 212 He must have lived in the early part of the 12'h century. As the other members of the Rva family in the Kiilacakra lineage, Rva Chos-rab and Rva 'Bum-seng, he was also a lineage-holder of the cycle of Yamiintaka. This was a heritage from Rva rDo-rye-grags who was the most important to introduce this tan/ra in the II 46

make invitations to Hva-shangi 76 from China, and consequently he invited one from Minyag,277wh~ had become a Hva-sh.ang. [That one] was made chaplain of the kin~, [and] among the lIneage of ancestors, which was made out of only tantrics who had practIsed the complete established texts and traditions of the Mahiiyiina,278 there was one called Mi-nyag gzhon-nu snying-po from Yar- 'brog-sganl79 and his son gZhon-nu seng-ge, and his son Rig- 'dzin snying-po, (p.66:2) who settled in the country of rGya-ma of Rong.28o His son rDo-rje seng-ge took possession of Rong mKhar-phul 81 The eldest of the four sons born to him, named Ye-shes rdo-rje,282 being learned, appeared to be one who had acquired perfection. He rYe-shes rdo-rje] obtained perfection with [the help at] (p.66:3) the precepts of the Mahiimiidra renowned as dByug-Chos,283 [and] took possession of [the monastery] dBen_dmar 284 , the abbatial seat of someone called dBang-phyug rgyal_po.285 274 He lived 1203-1282 (Macdonald. 1970:177-78,182). There are five Tibetan folios written about this blama by Bu-ston, which makes him the most important of all the tradition-holders mentioned. rGa-Io rNamrgyal rdo-rje is the first to be dated in BlI-slon's text (p.66:4, 71 :5). gZhon-nu-dpal presents the same dates (Roerich. 1949153:790,796). rGa-Io was considered to be the incarnation of Khams-pa rGa-Io-/sa-ba gZhon-nu-dpal (1110/14 - 119811202) (p.66:3; Macdonald. 1970:177-78). In The Bille Annals there is only one rGa-Io indexed, but it is obvious that two existed. An interesting fact seems to be that the earlier Khamspa dPal-chen rGa-Io was also a master of the Kiilacakra (Roerich. 1949153:555-56,713). He is not mentioned in the usual Kiilacakra lineages, but was evidently initiated into the system. According to Tibetan Buddhist thinking, rGa-Io rNam-rgyal rdo-r}e must have had strong former inclinations to study the Kiilacakra. Through the 'Bra lineage rGa-Io rNam-rgyal rdo-rje was also a lineage holder of the Yamiin/aka tantric cycle.(Roerich. 1949/53:379). As Bu-ston's text states he was a member of an old family from the royal period in Tibet in the 8th century (p.66:1). The fore-going gives a picture of an important master of the 13th century who is otherwise not very well-known. 275 Or Sang-zhi. This seems to be a version of the story about Sang-zhi of the 'Ba clan who went to China and Mi-nyag in order to obtain texts on Buddhism and Taoism. It was in the last years of king Mes- 'ag-tshom, who died in 755 (Stein. 1984:37,42; Shakabpa 1984:32-34). It is possible that he also invited Chinese Buddhists (hva-shang). If he was from the dBa' clan that rGa-Io belonged to . The contact with Chinese religion had some importance for the future. 'Gas lo-/sa-ba more explicitly states that Sang-zhi was sent to invite monks (Roerich. 1949/53:789,41). 276 Chinese Buddhist monk or scholar (Das. 1903: 1326). 277 Mi-nyag is a small Tibetan area in eastern Kham near the Chinese border (Stein. 1984: 14-15 map). Consequently it was a Tibetan who was invited, who had become a Chinese Buddhist teacher. 218 It was important for Bu-ston in this context to stress that they were tanlrics well based in classical Mahiiyiina, possibly in order to defend the legitimacy of his Kalacakra interest. 279 This person is obviously someone who carne from Mi-nyag, but who later settled in the area of the lake Yar-'brog in central Tibet south of the river Tsang-po. 280 These two persons are unidentified but Rig-'dzin snying-po settled in the Rong valley situated between Lhasa and gZhis-ka-rtse in the gTsang province (Ferrari. 1958, map; Wylie. 1962: 140). The family continued to live in this region. 281 Unidentified. The monastery is also unknown, but should be situated in the Rang valley. '" As his son rGa-lo was born in 1203, he must have lived in the late 12th and at the beginning of the 13th century. 'Gos lo-tsa-ba writes that it was dBang-phyug rgyal-po who received the Mahiimudrii teachings, but Bu-ston is quite clear about it being Ye-shes rdo-rje (Roerich. 1949/53:789). '" 'Gas lo-tsa-ba has written a whole chapter on the tradition of Mahiimudra (Roerich. 1949/53:839-866). There is an explanantion of dByug-chos by Roerich in his translation of the Blue Annals. dByug-chos means a secret doctrine written on a roll of paper, and hidden inside a bamboo stick, used as a walking staff by yogis." 284 This monastery was situated somewhere near the Rang valley just between the provinces of dBus and gTsang. It was then kept in the family as noted later in the text (p.71:6, 72:4 and 73:1). See also Roerich. 1949/53: 790,791,792 and 793.

47

As for his rYe-shes rdo-rje's] son rJe"btsunrGa-Io, the father gave [him] a name like that after being supported by a sign [in a dream]. He thought that he [rGa-Io] was a rein. carnation of the former Khams-pa rGa-Io-tsa_ba. 286 (p.66:4) At the time when Kha-che pm:z_chen287 came to Ngur_smrig,288 he [rGa-Io] was about three years old. [And] after being taken by Ma-gcig Jo-sras ma-skyi-mo/ 89 as she went to receive blessings and dharma-teachings [from Kha-che], (p.66:5) it was prophesized [by him] that he [rGa-lo] was going to be excellent in Sanskrit. He [Kha-che] took him by the hand, and as he [rGa-Io] was relieved, almost everybody assembled perceived that he was a holy man. And rJe-btsun [rGa-lo] even [used to] say to himself: "At the time of childhood I met bLa-ma PalJ_chen290 himself and I was going to be relieved by [[[Wikipedia:learning|learning]]] Sanskrit." (p.66:6) When he [rGa-Io] was young, according to prophecy, he learned to write and read, the 'Jig-rten bstan-pa 291 and the Phung-po lnga'i rab_byed292 and the sPyod- 'jUl 93 and the mDo-sde las-manl 94 and the smaller section of the Mildhyamika and the Donzhagi95 (p.66:7) and the doctrine of [the method] for calming the bag-chagi 96 and so forth. [All] these different kinds [of teachings] he learned from his father. After that, he [rGa-Io] came into the presence of dPyal Chos-kyi bzang_po/97 and during three years he Unidentified. See note 274. 2'7 Siikyasrzbhadra (1127-1225). He came to Tibet 1204 and stayed there until 1222, when he returned to Kasmir where he died in 1225. He was interested in Kiilacakra and MaiijllsrzniimasaJigW (Naudou. 1968: 196-97). He translated a Kiilacakra-text, Sri-kiilacakra-sahaja-siidhana, by Kiilacakra-piida. (Cordier Rgyud IV,9). 'Gas la-tsa-ba gives the same story as BlI-stan (Roerich. 1949/53:770,790,797). '" It was difficult to find any information on Ngur-smrig. The only information that I could find is from gZan-nll-dpal that ICe 'Dul- 'dzin of gTsang-rang founded the monastery-college (bshad-grva) of Ngursmrig (Roerich. 1949/53:80). The monastery is also mentioned in connection with the reconstruction of bSam-yas after a fire in 986. Rva la-tsa-ba rDa-rje-grags contributed a large donation for the reconstruction of the monastery. He also supported and made offerings to the monastery of Ngur-smrig in gTsang. The monastery is mentioned here as the place where rGa-Ia was raised. The monastery was therefore connected with the Rva family from at least the end of the II th century when reconstruction occured (Roerich. 1949/53:378).The location is situated somewhere near the Rang valley in gTsang. The word actually means "reddish colour" (Bod rgya tshig mdzad chen mo. 1985:654) and is the name of the colour of the robes that Buddhist monks wear. Consequently, the word might mean that the person was wearing the saffron robe and was a monk, in this case the Kasmir monk Siikyairibhadra. 289 The name is unidentified, but is probably the name of rGa-Ia's mother. 290 This is Sa-skya Pa1J4ita Kun-dga' rgyal-mtshon (1182-1251) who is generally known by that name. He was actually known as a Sanskrit scholar. 291 'Jig-rten bston-pa (Lakaprajiiapti) is the same as the text 'Jig-rten bzhog-pa TohA086. 292 Phung-po lnga'i rab-byed, skt. Poiicaskandha-prokara(la is one of the texts Toh. 3866 or 4066, but most probably 4059. 293 The text Badhisattvaciiryiivatiira by Siintideva. Toh. 3871. 294 Skt. KarmovibhaJiga. Toh. 338, 339 or 340. 295 Dan-zhags can be one of several texts; Toh.683, 686, 687, 689, 903, 2721, 2861and 2864. 296 Skt. viisanii, "karmic imprints". The traces of the former inclinations in earlier lives. These imprints decides much of the present life but can be calmed by certain methods. 297 He is also mentioned in The Blue Annals (p.379) where it is stated that he also received the red Yomiintaka; on p.396 it is mentioned that the dPyal family traced its origins back to a minister of king Khrisrang lde-btson, something that indicates that this family, like the Rva family, was part of the old Tibetan aristocracy. He had also received the teachings of Vajraviirahi. 285

286

48

[rGa-!a], after having studied to write Indian and read Indian [[[language]]] and the different varieties of the language Sanskrit,298 (p.67:1) and after having studied particularly Hevajri 99 and Vajraviirah"i 300 at the age of sixteen, explaining in a good way at Ngur-smrig, spread the teachings. As for other [texts] he learned the Great Commentary of Nii_ra 30 ! with the instructions, and the small Samvara-siistra 302 with instructions. (p.67:2) When he [rGa-la] was receiving the empowerment of Samvara with the instructions, hearing wonderful sounds from the centre of the mm:ujala,303 having had blood dripping from the nose, after having dreamt of the dropping, he purified his disease and mental obscurations. [And his] pleasure-body 04 became like shining wisdom. (p.67:3) When he received the empowerment of gShed-dmar, 305 he was freed from the temptations ofMiira. So then, now, earlier when he[rGa-Ia] resided at Da!-chuni 06 when he was a little bit sick, [somebody] made hindrances [to him]. (p.67:4) A visiting monk, after having come in front of him carrying an Indian book with a supplement, took out one volume, and waving it in front of his [rGa-Io's] eyes said:"As for the words, you will not grasp them, (p.67:5) and as for the meaning of the holy [teachings], you will not understand it." [And they] disputed so. And [then], at night, he [the monk], after having undressed naked, and

"Siikyasrl bestowed on the lo-tsii-ba dPyal Chos-kyi bzan-po the conunentary on the Hevajratantra composed by Nii-ro-pa and Nii-ro's precepts on SQljangayoga. dPyal expounded them in a book calle? Rin-po-che sgom-gyi Ide-mig."(Roerich. 1949/53:797). This confirms that dpyal received teachings from Siikyasri after his arrival to Tibet in 1204 and before his death in 1225, and consequently brought these teachings to rGa-lo later. One of dpyal's disciples was bSam-gling rin-po-che (1189-1260; Roerich. 1949153:518-519) who belonged to the Dags'jJo bKa '-brgyud-pa. It can be concluded that dPyal Chos-kyi bzang-po lived at the end of the 12'h century and the first half of the 13 th century. In Griinbold. 1966:146 it is mentioned that dPyal was one of the tradition-holders of the $a¢angayoga. 298 It is actually written that he learned different ways of pronouncing the Sanslait language. 299 Tib. dGyes-rdo-rje; Here it stands for the whole cycle of Hevajra. 300 The tantric text of Vajraviirahi; tib. rDo-rje phag-mo. In Tibet, the only female incarnation with a position comparable to the higher incarnations of other schools. She belongs to the Karma-pa school and each incarnation is reborn as the abbess of the bSam-lding monastery on the shores of the Yar- 'brog lake in southern Tibet. 301 This could be the Sekoddefa-rikii (Toh.l351), which is the well-1QlOwn conunentary of Nii-ro-pa on the only surviving text from the root-tantra (malatantra), Sekoddefa (Toh.361). The text has been edited (Carelli. 1941) and recently edited and translated into Italian by R. Gnoli and G. Orofino (Orofino. 1994a and Naropa. 1994). It could also be Niiropa's big Hevajra conunentary, Toh.l181, attributed to sNyan-grags bzang-po [*YasobhadraJ in the bsTan- 'gyur.. . J02 This must be a commentary on the main text on Samvara (Cakrasamvara) (Toh. 368). Tib. 'Khor-lo bDemchog. The tantric cycle of Cakrasamvara has connections with the Kiilacakra cycle. It may be Toh. 1402, VajrapiilJi's Sal'{lvara-!fkii, a conunentary on the first chapter ofToh. 368. 30J Here is probably meant the Cakrasamvara ma(lfjala. 304 Tib. long-spyod-skyi-sku. Skt. sambhogakiiya. 305 This is gShin-rje gshed-dmar-po, the red Yamiintaka. See also Roerich. 1949/53:379. The basic text of this tantric system is gShin-rje gShed-dmar-po 'i rgyud, Toh. 474. 306 Dol-chung. I have not found the location of this place, but the only name that is similar is the region of .Dol-po in the Tibetan area of northern Nepal to the west of Annapurna and Mustang. The JO-Ilang-pa master Dol-po-pa came from that region. Dol-chung could be a "small" part of Dol-po.

49

after having placed on his head a small piece of Clay from the temple, said: "I am the c1aymade Garuga-headed." And he threatened him [rGa-lo] and so forth.307 (p.67:6) Further again, when he [rGa-lo] after arrival at Ngur-smrig, in a dream there came an old monk who was carrying a load of boots without soles saying: "[You are] the friend that 1 could not find [for such a long time that] 1 have worn out so many shoe soles [as 1 am carrying], and now [that I] have found [you] 1 am very glad." He [the monk] was very happy and he began to go around him [rGa-lo] , following after him. And he [the monk] was acting as to help him [rGa-lo] in a cheating way. (p.67:7) After that, when he [rGa-lo] arrived at his own monastery, as his father said: "Last night there was great magical disturbances of bgegs, 308 you should not trust your mind [that you could get] help [from a bgegs]. (p.68:1) You should do the most excellent thugs-dam (meditation)." He [rGa-lo] thought in his own mind: "As for these 'byung_pos,309 they act as like to help, but [they] are doing hami.." He [rGa-lo] generated a [strong] noble mind, which could not move to the external world, and he said mantras many times. (p.68:2) And they [rGa-lo and the 'byung-po] quarrelled and he [rGa-lo] even made like opening wide [his mouth to frighten the 'byung-pos]. [But] they did not have fear. Sometimes [they] changed [to be] like teachers, [and one 'byung-po said:] "For many lives we were friends, in this life [we did] like this [quarrelled], and [we] became perfected in such a good way." And he [the 'byung-po] explained introductory stories of all sorts of different lives. (p.68:3) Sometimes he [the 'byung-po] came appointed as a master of a gTsug-lag-khang, 310 [and] said: "As for my gTsug-lag-khang [it is] this. As for the earlier history [it was] like this." [And] he [the 'byung-po] explained all sorts of sayings, and said:" Even you, if you do the same as 1 do, you can act as to be a master like this." (p.68:4) Sometimes he [the 'byung-po] came in the form of a scholar and explained: "As for the tradition of the gzhung (basic texts), [it is] like this. As for former times, [it was] like this. As for the future, [it will be] like this. Even you can act in this way." Sometimes he [the 'byung-po] acted as a magician and explained: "As for the real substances and medicine and mantras, [they are] like this. (p.68:5) [And] if you are close to such a one [a magician]; [then you] become like this." Sometimes in the form of a big grey bird, he [the 'byung-po] transformed his words into human language, and after having remained beside [rGa-lo] in a very loving way, at the time of the early moming, when he flapped the wings with much noise and called [rGa-lo] with the names: "Zla- 'od gzhon-nu, 307 This story is quite strange but can be seen as someone putting rGa-Io to a test. As is usual in a lanlric context he has to endure some difficulties in order to progress in the lantric way. 308 This is a class of demons, whose speciality is to cause hindrances and to obstruct. See NebeskyWojkowitz. 1956:285, where they are described as obstacle-creating demons, who are supposed to obstruct al1 religious activities. See also Das 1903 :925, where it is stated that the bgegs are a sort of demons divided into eighteen classes. "9 See Nebesky-Wojkowitz. 1956:380, where it is mentioned that the 'bYllng-pos are demons causing mirages or illusions. This is very much the case in this text where the 'bYllng-pos are trying to cheat rGa-Io. See Das. 1903:925. Skt. bhala, which is a general name for the three classes of demons called 'dre, gdon and bgegs. In Bod-rgya tshig-mdzod chen-mo. 1985:1981 it is said that they are formless harmful beings. The 'byung-po is also mentioned as being without form in Stein.1956:42,219, fol.6a and 63, 247, fol. 43b. See also Berglie.1983:118. 310 gTsug-Iag-khang means temple/monastery, vihiira, but in later times normally meant the assembly hall or main hal1 of worship. Here it seems to mean a monastery.

50

Seng-ge rgyal-mtshan 'Od-kyi nyi-ma,3[[ he said: "Get up! Investigate closely! Do meditation! Explain the philosophical texts!" [Then] as he [the 'byung-po] was acting as if to do work for the dharma, when he [rGa-lo] was trying to get the empowerment of gShed_dmar312 at Thar-pa 3l3 , he [the 'byung-po] said: "It would be better if you went home. (p.68:7) Your father and mother and others are sick. You should meet them and look after them. As for the empowerni.ent, it is proper to get it later." [Then] as he [rGa-lo] said: "It is difficult to get it later. Therefore [1 want] to get it now." (p.69: 1) He [the 'byung-po] answered: "After having cared about you so much, if you act like that, it is very unwise. Now, go back [home]." And he [the 'byungpo] even helped him [rGa-lo] to lift up the food and the [other] burdens. And as he [rGa10] said: "Even [ifit is] like that, I must take [the empowerment]." He [the 'byung-po] threw the food and the burdens under the staircase and said: "I, being a friend of yours for a long time, have been cheated [by you] . (p.69:2) You can do whatever you like, as for me, I am leaving. You, accompany me a short distance." He [rGa10] accompanied him [the 'byung-po] to Mo-dben sgang_khar314 of Thar-pa-gling. 315 And he [the 'byung-po], having mounted on the horse which was there, was elevated to the sky and the horse was transformed into the form of a lion. And looking like the gnas-brtan called dPon-go-rub,316 he leaned his cheek in the hand, singing. (p.69:3) And he [rGa-lo], having passed an old man who had grey hair, went away. Ever since that time the disturbances of Miira (tib. bdud) did not harm him. 317 Later, when Sa-skya PalJejita was· at a dharma-school near the Byang-thang, 3 [8 he [rGa-lo] met him, (p.69:4) and because he [Sa-skya PalJ4ita] was praying: "You, being of young age and of good family, you are going to learn, because of your great wisdom, [to be] like someone [who is] omniscient." After having been promised that, later atgZhu-dburgyan,319 requesting the empowerment and the siidhana of Nag_po_pa 320 and the empowerment of rNam- 'joms 321 [and] A-ra-pa tsa_na,322 he [rGa-lo] was accomplished according to the promise. JIl I have not found any reference to these names. Probably they are only epithets given to rGa-lo in order to give him prestige. Here it is part of a strategy of how to cheat rGa-lo. 3I2 See note 305. m Thar-pa or Thar-pa-gling. 314 The name is unidentified, but should in the context have the meaning of a special part of the monastery. JI5 Thar-pa-ling is situated on an old route from Sha-lu to Ngor in the gTsang province. To the south lies the site of Thar-pa-ling monastery. It was founded in the 14th century by Thar-pa lo-tsa-ba, a teacher of Bu-ston and a renowned translator (Dowman. 1988:272; Roerich. 1949153:751,829). 316 gnas-brtan is skt. sthavira, a senior (elderly) monk. The name is unidentified. 317 The whole of this story about the 'byung-po demon (p.67:9 to p.69:3) is very interesting and seems very typical for this type of demon that always try to cheat the faithful Buddhists. rGa-lo succeeds in defeating this demon, actually said to be an envoy of Mara. The demon leaves, disappointed with rGa-lo 's attitude, because it could not defeat rGa-lo. 31. the northern plain", the name for the great northern part of Tibet. 319 See Roerich. 1949153:792. There it is mentioned that the son of rGa-lo, Shes-rab seng-ge (1251-1315) preached at a monastery caIledgZhu Kun-dga'-ra-ba . . 320 This is probably the Cakrasamvara tradition of Krsna acarya, Toh.431, 1445-48. ill. ' . ... . . Skt. VlSphotakah. See Mahiivyulpalll, Part 1, p.233, nr.3345. It IS accordmg to Edgerton 1972 (1953):504, . the name of a naga divinity. l22 This is a name used for the bodhisattva Maiijusri.

51

(p.69:5) Furthennore, having adhered to bLa-ma 'Jam-gsar,323 he received well the instructions of many commentaries [Buddha]-words of the outer philosophy and gSheddmar of the tradition of Dti-na Sf_Ia 324 and the empowennent and sa.dhana of Tara.,325 and particularly the empowennents and instructions of the 'Bro school of Ka.lacakra. (p.69:6) After having adhered in a good way to bLa-ma Rva 'Bum-seng,326 and after having completely obtained all the blessings of the empowennents and instructions of the Rva school, of which the most excellent is Ktilacakra, he [rGa-Io] became a treasure of the tantra-class. (p.69:7) After having adhered to ICe-ston mdo-seng-ge,327 he [rGa-lo] received properly the Yoga of the Guhyasamtija 328 and Ma.iijusrfntimasangltistidhana 329 and others. (p.70:1) After having adhered to PalJ¢ita Vibhiiticandra 330 and Khro-phu lo-tsa-ba Byamspa'i dpaP31 and others, he [rGa-Io] learned many instructions and profound dharma[teachings]. He [rGa-Io] learned from 'Gro-mgon chos-rgyaP32 the empowennents and

See note 248. This is the red Yamiintaka of Dii-na-.ff-Ia. See Bod rgya tshig dzod chen mo. 1985:1236. There it is stated that DiinaSiia was from Kasmir and lived in the 8'" century. He was one of the three translators and pw:uj.itas that were invited by the king Khri-srong Ide 'u-blsan. This might also be a later DiinaHla. 325 The female bodhisattva, tib. sGroi-mo. 326 See notes 272-275. 327 LCe is one of the old aristocratic families in Tibet which can trace its lineage back to the old royal times. The family founded the monastery of Sha-lu in 1040 (Stein. 1981:5Q and 201). Two members of the ICe family were disciples to Somaniitha in the II'" century and they Invited him to stay in Tibet (Roerich. 1949/53:759-60 and 766). Lee ston mdo-seng-ge was a member of this family and he was also a lineageholder of the Mahiimudra, Vajraviirahi and Zhi-byed (Roerich. 1949/53:866,397 and 905). 32. Sanskrit editions in Bhattacharya. 1967 (1931) and Matsunaga. 1975. Translations by Freemantle (unpublished dissertation) and to German by Gang. 1988. Tibetan edition, Toh. 442. See also Wayman. 1977. 329 There are some canonical texts on the MNS. The basic tantra is the Toh.361 and the commentaries are found in Toh.l395-1400. There is no special text with the title of siidhana but there are obviously many siidhanas used. It is worth notice that various authors and translators of the canonical texts on the MNS are the same as the ones working with Kiilacakra texts. The best example is Toh.l398 AryaMafijusrfniimasangftitfkii-vimalaprabhii by Rgyal-po Padma dkar-po (skt. Raja Pu1J4arika), translated by bSod-snyoms-pa chen-po (skt. Pi1J4o) although this might be a false ascription. They were also active in translating Kiilacakra texts. This is another indication of the close ties between these two teachings. 330 Vibhiiticandra lived at the end of the 12'h century and the beginning of the 13 th century in Nepal and received different Yoga-teachings, for ex. the ~a4anga-yoga, from Sa-ba-ri dBang-phyug. Vibhiiticandra then called on Ko-brag-pa from Tibet and gave him the secret teachings of the Sa4anga-yoga. Ko-brag-pa then invited Vibhiilicandra to Ding-ri in Tibet and received all the precepts of the ~at/.anga-yoga (Roerich. 1949/53:727, 796). It seems that Vibhiiticandra was in contact with the famous pa1J4ita Sii!cyasrf-bhadra who visited Tibet in 1204-1225 (Roerich. 1949/53:799). rGa-Io invited Vibhiiticandra to dBen-dmar and Sambharobtained several Kiilacakra teachings and initiations from Vibhiiticandra (Stearns 1996:146). 331 Khro-phu was born in 1172 and was the one who invited Sii!cyasrf-bhadra to Tibet in 1204,and worked as an interpreter and translator for him and died in 1217 (Roerich. 1949/53:306, 599 and 708-711; Stearns. 1996:130). gZhon-nu dpal has devoted a chapter to his spiritual lineage. Khro-phu's main guru was the Indian master Mitrayogin (Roerich. 1949/53:1033-1039). In this context he is only mentioned as one of the teachers of rGa-Io. 332 This could be 'Gro-ba'i mgon-po 'Phags-pa who was also called Lha 'Gro-ba'i mgon-po (1186-1259). He was a famous master and an abbot of the monastery of Po-to (Roerich. 1949/53:278-279). This is not the historically known 'Phags-pa. 323

324

52

dharma-teachings of Dril-bu-pa,33J the dharma-teachings of Mahamaya,334 the tantra of Hevajra 335 and so forth, the instructions of the protectors as Mahakiila 336 and so forth, and siitraS as SaddharmapulJ¢arika 337 and so forth, and agamas as Bhavanakrama 338 and so forth and Rigs-gter. 339 (p.70:2) Furthermore, after having adhered to dPyal A-mo_gha 340 and mKhan-po phag and sLob-dpon Dharma-gzhugs and 'Bum-pa 'od-se and mTsho-yangs-pa-snyan Darma rgyal-mtshan and Srin-po ri-pa mKhan-po-'jam 341 and mKhan-po Seng-ge zil_gnon 342 and Yar-'brog bsNyan-ston 343 and so forth, (p.70:3) he [rGa-lo] became a rich man [spiritually] through the profound and great dharma. (p.70:4) Furthermore, his [rGa-lo's] main disciple rGya-gar grags_pa 344 and the disciple gZhon-nu rgyal-mtshan,345 because the two of them were taken by the Hor 346 army, he [rGa-Io] made a piija of Tara 347 to free [them] from prison, after that he had seen in the hole of the navel of a Tara so big so as to fill the sky, the heads of two children sticking together. (p.70:5) And because he [rGa-lo] accomplished his intention [to set them free], in about three days the main disciple escaped, and in about one month even the [other] disciple changed his mind and escaped. At sNar-phu'i dgon-pa mdzo-sgang/ 48 there was the J33 Slct. VajraghaIJia. Dril-bu-pa was an Indian master who taught the Cakrasalflvara Tantra (Toh.1431-39). There exists a lineage which shows that he was active during the first introduction of Buddhism to Tibet in the 8th century (Roerich. 1949153:384-385; Bod rgya tshig mdzod chen mo. 1985:1332). There also existed a special teaching on the Cakrasamvara by Dril-bu, which accordingly could be the teachings transmitted to rGa-Io (Roerich. 1949153:389). 334 Mahiimiiyii is a tantric teaching and a divinity in the Tibetan canon. He is very fierce and causes creation and destruction. He creates and destroys himself and is a sort of overlord (Newman. 1987:402; Peking #64, vol. 3, 63/4/2 - the Mahiimiiyii-tantra-riija-niima TohA25). An edition of the Tibetan text and a restored Sanskrit edition of the text has been published in Sarnath (Mahiimayiitantram \992). See also Edgerton. 1972 (1953):424. 335 Hevajra-tantra. TohA18, P.IO, translated in Snellgrove. 1959. 3" The tantric protection deity Mahakiila. There are several texts concerning this divinity. In Tibet he is very popular as a protective deity. 337 A classical Mahiiyiina text (transl. by Kern in Saddharmapur;4arlka 1974 (1884). Concerning the text see Nakamura. 1987:183-191. 3" The text was written by Kamalaslla (8 th century) who belonged to the Mahiiyiina school of YogiiciiriiMiidhyamika. On the text see Nakamura 1987:283. 339 These are texts on logic (mtshad-ma). (Bod rgya tshig mdzod chen mo. 1985:2688). 340 dPyai is an old aristocratic family from the first introduction of Buddhism to Tibet (Bod rgya tshig dzod chen mo. 1985:1644). It is also name of a place (Das 1903:794). 341 I have not found any information on the foregoing five teachers of rGa-lo. 342 He heard teachings from Siikyasri at the beginning of the 13 th century. It appears that Bu-ston received teachings on logic from the tradition of Seng-ge zil-gnon (Roerich. 1949/53:82). 3" No information could be found, except that it can be supposed that he came from the area of lake Yar'brog in southern Tibet. He is here presented as the foremost disciple of rGa-lo. He escaped from Mongolian captivity with the help of rGa-lo. 345 There was a gZhon-nu rgyal-mtshan who was a disciple of Chag lo-tsa-ba in the 13 th century who was active in the monastery of Thang-po-che near the Yar-lung valley in central Tibet (dBus) (Roerich. 1949/53:94; Naudou. 1968:196-197 and Roerich. 1959). 346 A designation of Mongolia or other Tartarian people in Tibetan. In this case it can supposed from the context that Hor means Mongolia (Roerich. 1949/53 :94). 347 Tib. sGrol-ma. 348 The monastery of sNar-phu, which is not identified.

3"

53

only son of a married couple [who was] dumb and unable to walk. He [rGa-lo] made actions of connection between cause and effect, and because he [the dumb] changed clothes and was given a new name, he was made to know how to talk and walk. Furthermore, he [rGa-lo] proceeded in this way with many dumb and crippled. [Then someone] (p.70:6) called sTon-pa gzhon-brtson 349 at Thar_pa_gling,350 [had] an affliction of pus and blood [because of] a big inflammation, one could even see the heart and the lungs. And he changed his name to sTon-pa-ra:-tser. (p.70:7) As it was written above the door: "sTon-pa gzhon-brtson is now sTon-pa ra-tser, sTon-pa ra-tse extinguishes bad talk," he [sTon-pa gzhon-brtson] was cured from the disease. In that way, when [someone] had a tooth-ache, because he [rGa-lo] filled up a crack in the fire-place, it helped. (p.71:1) And as [someone] was ill with head-ache, because he [rGa-lo] took out the nails from the door, it helped. And as [someone] was ill in the waist and wailing, because he [rGa-lo] drilled a hole in the wall of someone who could not have children, it helped. (p. 71 :2). And he [rGa-lo] cured insane and so forth, making limitless other benefits.35\ Particularly, because he [rGa-lo] made explanations of Kalacakra, he accumulated many disciples who became skilled in the Kalacakra, like the disciples, learned men and spiritual sons, Grub-pa 'j dbang-phyug Man-lungs gu_ru352 and lHo-pa grub_seng353 and Thang-ston lo_tsa_ba 354 and others. (p.71:3) Furthermore he [rGa-lo] brought to maturation many disciples abounding in the three [characteristics]: learning, faithfulness and good-

There is one iiciirya sTon-gzhon who lived in the 13 th and who was teaching the ~a4angayoga (Roerich. 1949153:678-679.

349

See note 315. In the text the following, six examples ofthis kind of contagious magic are given: Problem: two of rGa-lo 's disciples are prisoners of the Hor. Cure: rGa-lo has a vision of Tiira with two childrens' heads sticking together in her navel and he liberates the two children and thereby his disciples. Affliction: a son was dumb and unable to walk. Cure: rGa-lo made him change his clothes and his name and he was cured. Affliction: a serious inflammation in the lungs and the heart. Cure: the sick was made to change name, and the new name was written above the door. Affliction: tooth-ache. Cure: rGa-lo filled in a crack in the fire-place. Affliction: head-ache. Cure: rGa-lo removed the nails of a door. Affliction: pain in a waist. Cure: rGa-lo drilled a hole in the wall of someone who could not have children. The cures are mainly of two types. One is to change the name of the sick and the second is to do something that resembles the affliction. Both kinds of magic are hardly from Buddhist teachings. They must be seen as something inherent in the Tibetan culture later assimilated with Buddhism. 351 The great siddha Man-lung gu-ru who lived 1239-1300 wrote a well-known guide-book to boly places in India that he visited on his many journeys (Roerich. 1949153:790,640; Macdonald. 1970). 352 The great siddha Man-lung gu-ru who lived 1239-1300 wrote a well-known guide-book to holy places in India that he visited on his many journeys (Roerich. 1949153:790,640; Macdonald. 1970) 353 It is mentioned in the Blue Annals that fHo-pa grub-seng was also a disciple in the lineage of dPal Phagmo-gru-pa (Roerich. 1949153:335). 354 About this bla-ma, it is told that he also received the Tiirii-tantra from a Sri Vimalakirti who lived in the 13.'" century (Roerich. 1949153:444-447). 35.

351

54

Khro_phu_ba 356 and others. (p.71:4) ne sS , like 'Gro-mgon chos-rgyaP55 and mKhan-chen ~7 When he [rGa-lo] arrived to rGod-dkar-la from bSam_yas,358 as there came many robbers and thieves, he made many [tantric gestures] like looking harsh and making signs with the fmgers, and because he was 'not afraid, they [the robbers] asked for his [rGa-lo's] state of health, and as he burst out in laughter and so forth, they became intangible, with the . ill . signs of perfiectlOn. (p.71:5) In that manner, after having accomplished unlimited [benefit] beyond the reach of thinking, [in the interest] of himself and others, and after having reached eighty years of age, in the water-male-horse year [1282], in the early morning of the third day of the part of the month when the moon increases (yar-ngo) [the first half of the month], of [the month] ofthe Great Miracle (Tsho- 'phrul chen-po) [the first month], he [rGa-lo] died. His [rGa-lo's] main disciple rGya-gar grags-pa, named as ordained sLob-dpon Nammkha'-dpyal, 360 after having learned the many teachings of his [spiritual] father, like Kalacakra and others, he took possession of the abbatial seat of dBen-dmar36 1 And he constructed a study-place at the monastery, and after having made great actions of dharma, he died. The son [ofrGa-lo] bLa-ma Shes-rab seng_ge362 was born [in the year] iron-femalepig [1251].363 (p.71:7) Even at the time of his youth, having perfected to read and write well, he was studying the Kalacakra and at the age of sixteen he explained the Kalacakra. Having arrived at Thar-pa in his twentieth year, he requested the dharma-teachings of the dPyal_pa 364 [school]. (p.72: 1) At the age of twenty-two he [Shes-rab seng-ge] arrived in the presence of sTag-sde seng_rgyaP65 and during five years he exercised [himself] in Phar_tshad. 366 Particularly, he became a scholar of logic, and he even made examinations

This could be the famous 'Phags-pa of the Sa-skya-pa school. This coincides as 'Phags-pa was born in 1234 (Shakabpa. 1967:71). '56 It is difficult to see how this could be the well-known Khra-phu la-Isa-ba born in 1172, as mentioned in note 321. It must be another Khra-phu. 357 A mountain pass between Lhasa and bSam-yas (Ferrari. 1958, map, Roerich. 1949/53:258). '" The first monastery in Tibet situated south of Lhasa at the river gTsang-pa. 359 These are very special methods used by rGa-Ia in order to help even robbers and thieves to reach perfection. 360 Unidentified. 361 See note 284. 362 Shes-rab seng-ge (1251-1315) was the son of rGa-Ia and one of the main tradition-holders of the Rva school. He received the complete monk ordination in 1280 by Chas-rgyal Phags-pa (1234-1280) (Roerich. 1949/53:791-792 and Shakabpa. 1984:64-69), something that must have meant that he was one of the important masters of the time considering the position of Phags-pa as the effective ruler of Tibet at that time. See also Ruegg. 1966:87. '6l Also Rang-pa Shes-rab seng-ge. (Ruegg. 1966:87. Deb-ther sngan-pa foI.18a-19a. See also the implication of Rang-pa Shes-rab sellg-ge for the JO-Ilang-pa school and Dal-pa-pa in Stearns. 1999:13. 364 The dPyal clan (rus) has its origin in the time of the dharma-king Khri-srong-Ide-btsan. The school of dPyal-pa is less well known (Roerich. 1949153:395-396). 365 This was in the year of 1273 and as Shes-rab seng-ge stayed for five years with sTag-sde seng-rgyal; he stayed there until about 1278. A sTag-sde-ba seng-ge rgyal-mtshan (1212-1294) was a disciple of Ba-dang Rin-pa-ehe Rin-ehen rlse-ma and learned the Ktilaeakra from him (Roerich. 1949/53:783-784) and this must . be the same person as mentioned in this text. 366 Short for Phar-pyill (Prajiitiptiramitti) and Tshad-ma (logic). 355

55

in dBus and gTsang. 367 In his thirtieth year, he entered monastic life in the presence of bLama Chos_rgyaP68 and mKhan-po mChims,369 and after having been completely ordained he learned many dharma [teachings]. (p.72:2) After having invited Lo-tsa-ba Grags-pa rgyal-mtshan,370 he [Shes-rab seng-ge] received the empowerment of Vajramillil 371 and the Milfiju§rfmfllatantra 372 and others, and the Vaidyil~rilhga and others. After having taken possession of the abbatial seat of dBen-dmar, he made explanations of Killacakra for a considerable period (p.72:3) Furthermore he explained many dharma[ -teachings] in various monasteries such as Tharpa,373 Khro_phu,374 bSam-yas,375 sTag-Iung/ 76 gZhu Kun-dga 'ra_ba/ 77 Shangs-rtse gdong,378 sTon-mo-glung/79 gYus-dga '_ldan 380 and others. (p.72:4) At the age offorty-one, after having given the abbatial seat of dBen-dmar to bLa-ma rDo-rje rgyal-mtshan,381 he [Shes-rab seng-ge] settled at dMu.382 After having He moved around in Central Tibet as was the custom among monks seeking teachings and initiations. Mentioned in this context and at this time, this is probably bla-ma 'Phags-pa who died in 1280. 369 He was acting as the upiidhyiiya at the ordination ofShes-rab seng-ge as a monk in 1280. There was a mChims Nam-mkha'-grags who was the abbot of the sNar-thang monastery during the years 1246-1282. This is probably the other witness to the ordination together with 'Phags-pa (Roerich. 1949/53:282-283). mChims was one of the old clans of Tibet from the royal time in the 811> century. 370 Also called Yar-klungs lo-tsa-ba Grags-pa rgyal-mtshan (Roerich. 1949/53:792, 837). He lived in the latter part of the 1311> century and the first half .of the 1411> century. He participated in a translation of the Kiilacakra Tantra originally made by La-grags-pa (Roerich. 1949/53:780). He worked with his nephew, dPal Jigs-med grags-pa (1315-1391). Consequently he must have lived quite late in the first half of the 14'h century. He also translated the whole Kiilacakra-tantra-riija and the Sekoddefa-rikii (Roerich. 1949/53:837838) and some other texts (Roerich. 1949/53:350,379). The bla-ma Kun-dga' bzang-pa (1258-1316) invited Grags-pa in 1298 and received from him the Hevajra, Sekoddefa-rfkii, Sampu!a and the Kiiliipa-sutra. Consequently, he was a well-known Buddhist tantric teacher of his time. See also Ruegg. 1966:87, note 2. Ruegg underlines that this master, rDo-rje rgyal-mtshan, who was the teacher of Bu-ston, is not the same as the Kiilacakra translator Son-stan rDo-rje rgyal-mtshan. 371 This is a Guhyasamiija Vyiikhyatantra (communication from Newman June -04), probably Toh.445 with the commentary Toh.1795 372 Toh. 543, P.162. 373 Situated near the monastery of Sha-Iu and the town of gZhis-ka-rtse (see map in Ferrari 1958 and note 315). 374 Situated to the west of gZhis-ka-rtse (Ferrari. 1958:map). 375 As mentioned before, this first monastery of Tibet is situated to the south-east of Lhasa. 376 Situated to the north of Lhasa on the road to lake gNam-mtsho (Ferrari. 1958:map) 377 The monastery of gZhu Kun-dga'-ra-ba was built by rNgag in the first half of the 1111> century (Roerich. 1949153:75 and Ferrari. 1958:161). 378 The only mention is the same information in the Blue Annals (Roerich. 1949/53 :792). The monastery must be situated in the Shangs valley north-east of gZhis-ka-rtse. 379 This was a monastery in central Tibet (Roerich. 1949/53:1043). 380 Unidentified. 381 rDa-rje rgyal-mtshan (1283-1325) was the son of A-kiira-siddhi and consequently the grand~on of rCa-la. He succeeded Shes-rab seng-ge (1251-1315) as abbot of dBen-dmar in 1292, according to the present text. This seems quite unreasonable as rDa-rje rgyal-mtshan was only nine years old at the time. Later in this text it is said though that he took possession of the two, Shangs- 'bar [and dBen-dmar] at the death of Shes-rab seng-ge in 1315 (p.73:6). Earlier in this text (p.73:1) and in the Blue Annals it is said that rDa-rje rgyalmtshan took over dbEn-dmar in 1299 (Roerich. 1949/53:792) but in 1315 as well (Roerich. 1949/53:793). It is also said that.he departed for China in 1310 (Roerich. 1949/53: 793). However, Bu-ston says in this text that he departed for China in 1322 (p.73:7). This somewhat confused information is a reminder that the dating 367

368

56

founded Shangs- 'bar_tsa,383 he constructed a study-place and collected of tantras and texts on Viniiya, and he benefited many living beings. He gave many tantras to bLa-ma Tishri/ 84 the head [of the Sa-skya-pa] and other Sa-skya-pa lineages, (p.72:5) and as for others he had many disciples whO became great men and reached high positions, mainly the thr~e lo-tsa-ba's [translators] Yar,385 Thani 86 and dPani 87 who in their turn made to appear high positioned disciples who were heads of schools, good-hearted and noble. He especially had ~sciples. [who became] scholars of Kiilacakra. (p ..72:6) Thus, after h.aving collected ments for himself and others, he [Shes-rab seng-ge] dIed at Shangs- 'bar III the tenth day of the ninth month of the hare year [1315]. One [of rGa-Io 's] sons sLob-dpon rNal- 'byor388 took care of the estate. (p.72:7) Another [of rGa-Io's] sons [was] bLa-ma A-ka-ra siddha,389 who came to know the Kiilacakra from the schools of Rva [and] 'Bro, and the dharma-teachings of the Sa-skya-pa and the dPyal-pa. 390 His [A-ka-ra siddha's] son bLa-ma rDo-rje rgyal-mtshan was born in [the year of] water-female-sheep [1283].391 From the time of his youth, he exercised reading and writing. He became skilled in many variations of the Tibetan script. (p.73:1) After that, having trained in the Kiilacakra, he explained the Kiilacakra at the age of sixteen. After having requested bLa-ma 'Jam-dbyangs Rin-rgyaP92 and sLob-dpon Sher_rgyal393 to be mKhanof events in the old historical texts are not always certain. The most probable is that he, at least effectively, took over the monasteries in 1325 at a more mature age and when his predecessor died. In any case, rDo-rje rgyal-mlshan was a very important bIa-ma for Bu-slon as he was the one who taught Bu-slon the Kalacakra. Bu-ston studyed the Kalacakra with him for nine months (p.74:1). 3B2 A place name (Roerich. 1949/53: 78, 792). It can also mean a kind of evil demon. 3" This monastery was also situated in gTsang (Roerich. 1949/53:792, 793). From the name, it can be deduced that it is situated in the Shangs river valley just east of gZhis-ka-rtse (Wylie. 1962:71,140). )84 This should be the Ti-shri bIa-chen Kun-dga' bla-gros (Roerich. 1949/53:792,634). He was, according to the Blue Annals, born in 1299 (Roerich. 1949/53:308). Ti-shi (Ti-shri) was the title given by the Mongol emperors to the head of the Sa-skya-pa in order to install them as rulers of Tibet. )85 far-klung la-tsa-ba. for and dPang la-tsa-ba are mentioned as translators of the Kalacakra in the Blue Annals (Roerich. 1949/53:837-838). 386 Probably here is meant Thar instead of Thang in line with what is written in the Blue Annals (Roerich. 1949/53:792). There is also a Thar-pa la-Isa-ba mentioned in the present text (p.73:2) as a teacher ofrDa-rje rgyal-mtshan. It is also said that Bu-stan himself studied the ~a¢aitga-yaga with Thar-pa (Roerich. 1949/53:800). All this fits in well with the fact that Thar-pa was a disciple of Shes-rob seng-ge who died in 1315 and Bu-slan who was born in 1290 and was a young man when Thar-pa was active as a teacher. )87 dPang la-Isa-ba bLa-gras brtan-pa (1276-1342). A short biography is to be found in the Blue Annals where it is mentioned that he was a great master of Kalacakra, and also of Logic, Abhidharma and Vinaya. He made many translations (Roerich. 1949/53:785-787,345). He possessed extensive learning in many different Buddhist teachings (Roerich. 1949/53:534). He stayed at Sa-skya monastery at some period of his life (Roerich. 1949/53:634). 388 It is said in the Blue Annals that he was the third son ofrGa-la (Roerich. 1949/53:792). '" It is said in the Blue Annals that he was the fourth son ofrGa-la (Roerich. 1949/53:792). 390 Here A-kara-siddha had teachings from the dPyal-pa school. Very little is known about this school but it j~lassociated with the Sa-skya-pa. Ruegg. 1966:87-89. See note 381. 392 The information is repeated in Blue Annals (Roerich. 1949/53:792). There is information on a 'Jamdbyangs Rin-rgyal who travelled to the imperial palace in Peking in 1303 in the context of the succession of abbots of the monastery mTshal Gung-thang (Roerich. 1949/53:717). J93 Unidentified.

57

po and sLob_dpon,394 he was made a novice. 395 From the age of sixteen he took possession of the abbatial seat of dBen-dmar. (p.73:2) He attended the study-college of Kalacakra, [and] after having requested mKhan-chen bKa'_bzhi_pa 396 and mKhan-poZhal-snga-pa 397 to be mKhan-po and sLob-dpon, he was fully ordained. After having arrived in the presence of bLa-ma mKhan-chen Thar-pa lo-tsa-ba/ 98 he [rDo-rje rgyal-mtshan] learned the sGra Tsandra_pa,399 [and] he came to know all the traditions of writing of Kasmir and India and Singa_gling. 400 (p.73:3) Furthermore, he listened to many sadhanas and instructions on the Abhidharma. He [rDo-rje rgyal-mtshan] received all the main initiations, [for ex.] the Kalacakra in the presence of bLa-ma Shes-rab seng-ge, [and] he came to be skilled in everything concerning ritual (p.73:4), particularly when he made explanations of Kalacakra. He wrote [to the bla-ma] about difficulties of the [Buddha-]words, [and] after having arranged the questions and answers in order from the beginning, he became a great scholar. Furthermore, he learned the Abhidharma and Vinaya in the presence of Zhal-snga-pa, (p.73:5) [and] the initiation of rDo-rje phreng_ba 401 of the lineage of sGang-lo-tsa402 from bLa-ma mDzo-po lhas-pa Sangs-rgyas sgom_pa 403 and the instructions of Guhyasamaja [and] Hevajra of the Atisa404 school, the Lam- 'bras 405 and others. As for others, he received many tantras (p.73:6). In the presence of bLa-ma Sri'u chung-pa blo-ldan seng_ge,406 he [rDo-rje rgyalmtshan] learned many tantras [such as] Yo-ga and Guhayasamaja407 and Maiijusrfnamasangfti-sadhana 408 and rDo-rje gdan_bzhi409 and others. After that bLa-ma Shes-rab seng-ge had died, he [rDo-rje rgyal-mtshan] took possession of the two, Shangs- 'bar [and dbEn-dmar] (p.73:7). For a long time he learned and explained the Kalacakra. After that, through his fame and renown, as a consequence that it had penetrated in all directions, [he] was invited by the great king [the Mongol emperor of China]. After having gone to China in the year of the dog [1322], the great king and a great

394 upadhyiiya and iiciirya, the head of a monastery-college and spiritual teacher. These two were necessary in order to ordain someone as a Buddhist novice or monk. 395 Tib. dge-tshul 396 No other information found. 397 He also transmitted the Viniiya and the Abhidharmakosa to rDo-rje rgyal-mtshan ( Below, p.73:4 and Roerich. 1949/53:793). 398 As has been said earlier (note 376), Thar-pa was a disciple of Shes-rab Seng-ge and a teacher of rDo-rje rgyal-mtshan. 399 The grammar of Candragomin (tib. Tsandra-pa) Candra-vyiikaraJ;U1-sutra, Toh.4269 (Roerich. 1949/53:792). 400 Old name for the present SrI Lanka. 401 This is probably the Vajraval/by Abhayiikaragupta. 402 There are two sGang bla-mas mentioned in the 12'h century, sGang Ri-bo-che-pa and sGang Shes-rab blarna (Roerich. 1949/53:706). 403 Unidentified. 404 Tib. Jo-bo. 405 The teaching of the path and the fruit taught by the Sa-skya-pa school. 406 Unidentified. 407 Toh. 2584. 408 Tah. 361, P.3 409 It is probably the commentary Tah. 1611 to the basic CatuiJpf!ha-tantra texts Tah. 428 or 430.

58

number of ministers became believers. After being of great benefit for the living beings, on the first day of the tenth month of the ox year [1325] he [rDo-rje rgyal-mtshan] died. 410 (p.74:1) After having adhered to this bLa-ma [rDo-rje rgyal-mtshan] for nine months without a pause, I [Bu-ston] tasted some nectar of the speeches contained in the Killacakra branches. (p.74:2) Furthermore, in the presence of mKhan-po Lo_tsa_ba,411 I received many important points of the Great Commentary [VimalaprabhiJ], and many small instructions on the Killacakra and commentaries for example the Sekkodefa and others. During that [time] I [Bu-ston] did not break the vows [that I had given] to the bLa-ma, and I did not make adulterations in the explanations, [and] I succeeded in having instructions from the bLa-ma.

(p.74:3) As for another school of Killacakra, the disciple of Dus-zhabs-pa (Kiilacakrapada), SrJ Bhadrabodhi gave [the Kalacakra] to Gyi-jo Zla-ba'i 'od-zer.412 He [Gyi-jo] introduced [a tradition of] explanation of Killacakra and even taught for a long time. He only taught four [disciples] to know the Killacakra, [and] those did not continue the teachings. (p.74:4) A monk (dge-slong), a disciple of DilnasrJ,4I3 and bLo-gros sNying_po414 and Byang-chub shes_rab 415 and others, even those did not continue the teachings (p.74:5). Even the disciple of Abhaya,416 Khe-rgad 'khor-lo grags-pa 4l7 and Mi'i slobma,418 rGa_Io 419 and Rong-brling lo_tsa420 and sTeng-pa lo_tsa 421 and others, they also

As several of his contemporaries did during the Mongol dynasty, he went to China and the Msongol emperor's court. This means that he had a superior position within the Sa-skya-pa. Bu-slon was also a Sa-skyapa before founding his own school at Sha-lu. 411 This is probably a designation of rDo-rje rgyal-mlshan. 412 In the foregoing chapter I have written about the history of these pioneers of the Kafacakra. Above, chapt. 2.2.1., p.18-26. 413 There is a Danasrf mentioned as one of the teachers of AliSo in the 11 th century who does not fit this context. There is a possibility that this teacher had some connection with the Kalaeakra and in that way with the Kafaeakra tradition of Gyi-jo, who also had contact with A lisa. 414 He is also mentioned as a translator of the Kalacakra-Ianlra (Roerich. 1949153:837). 415 Unidentified. 416 This must be Abhaya. He is mentioned as a disciple of Naropa and also of Tsa-mi. He was one ofthe main figures in introducing theKalacakra to Tibet (Roerich. 1949153:760-61,765,795-96). 417 Unidentified. He is mentioned as a translator of the text Toh.1380 together with Jo-bo Ri-pa and written by Abhayakara (see above pA8). Consequently, there is a clear connection with Abhaya. 418 Unidentified. 419 Here rGa-fo is mentioned again. This time as a representive of the school of Gyi-jo. It is possible that he also received this tradition together with the 'Bro and Rva tradition, but it appears that like he didn't continue this lirieage. rGa-fa had already made the two traditions Rva and 'Bra come together in his person. Why then did he not integrate the tradition from Gyi-ja in his teaching? It is difficult to answer this question, but perhaps it did not pertain to the Sa-skya tradition to which rGa-lo mainly belonged. 420 There is a Rong-gling la-Isa-ba rDo-rje rgyal-mlshan mentioned in the Blue Annals. He was one of the many translators of the Kalaeakra (Roerich. 1949153:837). He was one of Abhaya's disciples: "At gNal-rOliliIis there was a student of the Kalacakra system, a disciple of Abhaya named Ron-glin lo-tsa-ba rDo-Ije rgyal-mtshan. His viMra called Sags-kha stands undamaged even today even now. I have not seen his biography and therefore unable to go into details." (Roerich. 1949153:1060-61). 421 sTengs-pa lo-Isa-ba Tshuf-khrims 'byung-gnas 1107-1190. He was one of many who translated the Kalacakra tantra. There is a short biography on him in the Blue Annals where it is also said that Chag dGra'beam studied Kalacakra with him (Roerich. 1949153:837,1052-54). He was active as a translator of many other texts (Naudou. 1968:192-94). 410

59

could not continue the tradition. Se lo-tsa-ba,422 after having learned the teachings [of KalacakraJ, he gave it to gNyos 'od-ma. 423 From that [person] the succession of the lineage of the teachings of the rTsa_ml424 school originated. ' (p.74:6) As a result there exists around 15 or 16 different translations of the Kalacakra. As for [those] who had [guarded] the teachings of Kalacakra, these three were the main ones. 425

422 Se lo-Isa-ba gZhon-nu Ishul-khrims is said to have studied the Vimalaprabhii with Tsa-mi on two occasions and also with Abhaya, Bhiiskara and Abhiyukla. He also visited India (Roerich. 1949/53:760-61,79596). 423 gNyos (Dharma) 'Od-ma was a disciple of Se IO-lsa-ba and he continued the Kiilacakra teachings of the Rva, 'Bro and Gyi-jo schools (Roerich. 1949/53:761-62). 424 Tsa-mi Sangs-rgyas gras-pa (11 th century) was a disciple of the well-known translator Bodhibhadra (see above, p.18-26 on Gyi-jo and Bodhibhadra) who was also the teacher and collaborator of Gyi-jo Zla-ba 'odzero Bodhibhadra appeared around the year 1000 (Naudou. 1968:151). Se lo-Isa-ba in his tum was the disciple of Tsa-mi and from him gNyos 'Od-ma received the Kiilacakra teachings. From him bKra-shis rin-chen received the teachings and in his turn U-rgyan-pa received the teachings. U-rgyan-pa (1230-1309) is said to have given the Kiilacakra initiation to Kubilai Khan after having travelled to Mongolia (Roerich. 1949/53;702). From U-rgyan-pa the school of Tsa-mi continued within the bKa '-brgyud-pa school and especially the 'Brug-pa school of the bKa' brgyud-pa to which U-rgyan-pa belonged (Roerich. 1'149/53;705). The recently deceased Karma-pa lama Kalu Rinpoche gave the Kiilacakra teachings partly according to the Tsa-mi school (Kalu Rinpoche. 1986:6). In that way, it could be said that the school of Gyi-jo and Bodhibhadra has continued to the present time. A short lineage of the Gyi-jo school is shown below, following Newman concerning the first names in the lineage (Newman. 1987a; 102-1 04). 425 'Gos lo-Isa-ba has still more information on the translators of the Kiilacakra (Roerich. 1949/53:837-38). It is rather unique that there were so many translations made of a text. It shows the great importance of the Kiilacakra Tanlra in Tibet.

60

2.2.3.0. Guru-lineages derived from the Dus-'khor chos-'byung by Bu-ston and The Blue Annals, by 'Gos lo-tsa-ba gZhon-nu-dpal.

Below I will present the lineages from the fore-going text, the Dus-'khor chos-' byung (The history of Kalacakra) and lineages from The Blue Annals. The lineages clarifies relations between important lineage holders and their place in the general history of Buddhism in Tibet.

Guru-lineage of the 'Bro school according to Bu-ston's Dus-'khor chos-'byung, p.61:2 -65:2.

f

!omanatha (arrival to Tibet 1064) ~

'Bro lo-tsa-ba Shes-rab-grags (2"d half of 11th century)

~sGom-pa dKon-mchog-srung

Gra-pa mNgon-shes

[,j..

(J Jth century) sGro sNam-la-brtsegs (llth century)

,j.. Yu-mo (±1040 - ±1I22)

,j.. Dharmesvara (b.±1085)

,j.. Nam-mkha' -' od

,j.. Nam-mkha' rgyal-mtshan

,j.. 'Jam-gsar

,j.. rGa-lo rNam-rgyal rdo-rje (1203-1282)

61

(1012-1090)

Guru lineage of the Rva school according to Bu;.ston's Dus-'khor chos-'byung, p.65:2 -74:2.

P~c7ita Sarnantasn (2nd half of the Illh century to first half of the 121h)

Rva lo-tsa-ba rDo-rje-grags

t

4 Rva Chos-rab (b.

( 1016-1100)

1060/70)

t

Rva Ye-shes seng-ge

Khro-phu lo-tsa-ba (1172-1236)

Vibhuticandra (2ad half of the

L

12~

dPyal Chos-kyi-bzang-po

~ Shes-rab seng-ge

t Rva Bum-seng

I t

Jam-gsar (the 'Bra school) rGa-Io rNam-rgyal tDo-rje (1203-1282) ~

Jj

(1251-1315)

.

Man-lung gu-ru +--_---l (1239-1315)

A-ka-ra siddha

t

rDo-rje rGyaI-rntshan (1283-1325)

t Bu-ston (1290-1364)

Guru lineage ofthe 'Bro school according to The Blue Annals (1478), p.765_788.426 426 In this lineage there are names mentioned not directly involved in the transmission of the Kalqcakra teachings. The lineage is very similar to the one given by Bu-ston and there is even more proof of the connection between the 'Bro school and the Jo-nang-pas. From Yu-mo up to Dol-po-pa the tradition holders were also heads of the Jo-nang-pa and Bo-dong Phyogs-Ias rNam-rgyal also had a strong connection with the Jo-nangpa. rGa-Io is not part of this lineage given by 'Gas lo-tsa-ba and in his place there is instead Kun-mkhyen-pa Chos-sku- 'od-zer (b.l214). This master has no place in Bu-stan 's Dus- 'khor chas- 'byung which means that here occurs the separation of the lineages within the 'Bra school. For some reason, 'Gas la-tsa-ba does not want to mention Bu-ston in this lineage. 'Gas la-tsa-ba was an abbot of the Kanna-rnyi~g monastery and

62

Dus-zhabs chen-po (skt. Kiilacakrapiida, the elder)

t

.

Sri Bhadrabodhi ± Gyi-jo

Dus-zhabs chung-ngu (skt. Kiilacakrapiida, the younger) ~

t

.

somaniitha (tib. Zia-ba mgon-po) ~ t ICe, father and son 'Bro lo-tsa-ba

t

sOom-pa dKon-mehog-srungs

t

Oro-ston gNam-la-brtsegs

't

Yu-mo [founder of the Jo-nang-pa 1040-1110]

t . ?harmeSVara Se-mo ehe-ba Nam-mkha' rgyal-mtshan

L

t

Nam-mkha' -od

Jo-'bum

t

"Jam-gsar Shes-rab 'od-zer . Kun-mkhyen Chos-sku 'od-zer (b. 1214) -".e

t

1

- Kun-spangs Thugs-rje brtson-'grus (b.1243)

'f mKhas~btsun 'f

L

.v--

A-ka-ra siddhi (son ofrGa-lo) Mun-me Brag-kha-ba Grags-pa seng-ge (b.1255)

Karma Pak~i-pa Yon-tan rgya-mtsho (1260-1326)

t sKyi-ston 'Jam-dbyangs-pa Dol-po-pa Kun-mkhyen Shes-rab rgyal-mtshan (1292-1361)---""1

t

-t

Dharmaswiimin Bo-dong Phyog-las rNam-rgyal (1303-1386)

t

Lo-tsa-ba bLo-gros-dpal [abbot of Jo-nang monastery]

Sangs-rgyas Rin-ehen-pa (1336-1424)

t 'Gos lo-tsa-ba gZhon-nu-dpal (1392-1481)

consequently of the bKa'-brgyud-pa tradition or perhaps a monastery of both the bKa '-brgyud-pa and rNyIng-rna-pa. It appears that the Kiilacakra tradition from Bu-ston continued with emphasis in the dGe-Iugs-pa school and possibly was not accepted by the bKa '-brgyud-pa. He does mention rGa-Io and Bu-ston in the Rva lineage and perhaps it was only that he did not consider them to have a part in the 'Bro school.

63

Guru lineage of the Rva school according to The Blue Annals (1478), p.789-795.

Tsi-Iu-pa

~ bSod-snyoms-pa (Pi1).c;lo)

~ Kalacakrapada, the Senior (Dus-zhabs-pa che-ba)

~ Kalacakrapada, the Junior (Dus-zhabs-pa chung-ngu)

~ MaiijukIrti

~ Samantasrl of Ye-rang (Patan)

~ Rva Chos-rab

~ Rva Ye-shes seng-ge

~

1

Rva 'Bum-seng

r-

Kha-che paI.J-chen (SiikyasrI)

rGa-Io-tsa-ba rNam-rgyal rdo-rje (1203-1282)

I'

his sons:

.t:}

)

Man-Iung-pa, the Great (Man-lung-guru) (b.1239) .

t~

Akarasiddhi; Shes-rab seng-ge (1251-1315); rGya-gar grags-pa; Aciirya rNal-'byor

~ rDo-rje rgyal-mtshan (1283-1325)

~ Bu-ston (1290-1364)

~ Chos-kyi dpal-ba

~ Tsong-kha-pa (1357-1419)

64

Another guru lineage according to The Blue Annals also gives space also to Dol-popa to be included in the Rva lineage. p. 756. .

"iJe-btsun rGa-lo (1203-1282)

tRong-pa Shes-rab seng-ge (1251-13l5)~

l

sKyi-ston 'Jam-dbyangs

rDo-rje rGyal-mtshan

t.

t

Kun-mkhyen chen-po (Dol-po-pa 1292-1361)

Bu-ston Rin-chen-grub (1290-1364)

This lineage provides a solution to the problem with the Rva and 'Bro schools being united in rGa-lo and Bu-ston. There is mention of another disciple (sKyi-ston 'Jam-dbyangs) to Shes-rab seng-ge who continued the lineage up to Dol-pa-pa. In the fore-going 'Bro lineage, sKyi-ston is mentioned as transmitting the Kalacakra to him. Here he is mentioned as part of the Rva lineage. Consequently, it can be said that Dol-po-pa received his Kalacakra tradition from both schools. .

Guru lineage of the Gyi-jo school of KaIacakra according to The Blue Annals, p.70203 and 795-96, Bu-ston's "A history of Kiilacakra", p.74, and Newman 1987a:102-04. Kalacakrapada (Pi1;u;lo)

t

Naropa (956-1040)

t

fri

Bhadrabodhi (I" half of the 11th century)~

Tsa-mi Sangs-rgyas grags-pa (lIth c.)

Gyi-jo Zia-ba'i 'od-zer (I" half of the 11th c.)

t

Se lo-tsa-ba

t

gNyos Dar-rna 'Od-ma

t . bKra-shis rin-chen t U-rgyan-pa (1230-1309) After U-rgyan-pa the teachings were probably continued within the different branches of the bKa' brgyud-pa school. There are other teachings mentioned which were continued within the Karma-pa hierarchs and their disciples and there is no reason to believe that the important Kalacakra teachings were not also continued. U-rgyan-pa also gave the . Kalacakra initiation to the Mongol emperor Khubilai Khan in Peking (Roerich

65

1949/53:703). Consequently the Kalacakra Tantta was given to the Mongol emperors. It is said that the malJcj.ala was made with precious stones which were then thrown into the water (Roerich 1949/53:702)

2.3. CONCLUSIONS. The conclusions that can be drawn from the present chapter are presented below. I will not repeat arguments found earlier in this text. This chapter is based on two Tibetan texts. The fIrst is the rNying-ma 'j chas- 'byung chen-ma by Nyang Ral-pa-can Nyi-ma 'ad-zer (11361204).427 The short relevant passages have been translated and analysed earlier in this dissertation. The other text is the Dus- 'khar chos- 'byung by Bu-ston. 428 When combining information from these texts and other material, a picture can be drawn of the introduction of Kalacakra to Tibet and its subsequent diffusion in that country up to the time of the compilation ofBu-ston's text (1329). The first to translate Kalacakra texts into Tibetan was almost certainly the Indian pandit BhadrabodhilBodhibhadra,429 together with Gyi-jo Zla-ba'i 'ad-zer some time after 1030 but before 1040/42 and the arrival of Atisa to Tibet. Because it is said that they stayed in mNga'-ris in the kingdom of the kings of Western Tibet, they were probably working with the translation before Atisa, whose policy was to be very cautious with the tantric teachings. Atisa obviously was well informed about the Kalacakra teachings as Bhadrabodhi was also his teacher, but he did not work for its spread. The fact that it is mentioned that they stayed in mNga '-ris for three years implies that they were invited, probably by the king Ye-ses- 'ad or Byang-chub- 'ad. After that, Somanatha and 'Bra Ses-rab-grags did their translation and diffusion work, although it seems like 'Bra did not teach extensively on the Kalacakra Tantra. The masters who really assisted the early spread seem to be dKon-mchog-srung and 'Gro sNam-la-brtsegs, who both received teaching from Somanatha. In the Rva school it appears that it really was Rva Chos-rab who did the fIrst diffusion work together with Samantasrf, who probably was a Newar Buddhist master from the Kathmandu valley. At that time the Rva teaching was very much a family tradition with the fIrst masters all belonging to this ancient clan. In the figure of rGa-la, the two traditions seem to have merged, according to Bu-stan, who gave him more space in his Dus- 'khar Chos- 'byung than any other master of Kalacakra in these early centuries. The importance of rGa-lo is something that has not been underlined in earlier research. His story is told in connection with the Rva school in Bu-ston's text. In writing on the 'Bra school Bu-ston only mentions rGa-lo very briefly. Perhaps this was a way for Bu-ston to mark his ideological distance to the Jo-nangpas who dominated the 'Bra school. Bu-ston does not mention his contemporary ideological adversary Dol-po-pa who was the main tradition holder of the Jo-nang-pa. He had actually no reason to mention him because he was not a master of Bu-ston. Meisezahl (ed.). 1985: Tafel 332.2.6 and 337.3.3. Bu-ston. 1965d:61-74. 429 See above, p.l8-24 for a discussion of the identity of this person. 427

428

66

In the end, it was probably Bu-ston who gave the Kiilacakra teachings it's high status and his tradition flourished with Tsong-kha-pa, mKhas-grub-rje and later with the dGelugs-pa schooL During that time there were other Kiilacakra teaching lineages in the other three schools of rNying-ma-pa, Sa-skya-pa and bKa '-brgyud-pa. It is interesting that in Buston's text a mention is made that there was a lineage of teaching from Bhadrabodhi and Gyi-jo that was not continued, although, in a way it was continued as Se lo-tsa-ba gZhonnu tshul-khrims studied with rTsa-mi who was a disciple of Bhadrabodhi. The tradition from rTsa-mi has been kept alive in the Karma bKa'-brgyud-pa school up to the present day.430 In that way the teachings from Bhadrabodhi, the master of both rTsa-mi and Gyi-jo, was continued. The 'Bro school of teachings has continued, especially in the Jo-nang-pa school up to its closure by Dalai. Lama V in the 17th century, and especially by the historian Tiiraniitha in the 16th century. The detailed history of Kiilacakra in Tibet after Bu-ston is not a subject for the present dissertation but requires it's own comprehensive study.

Kalu Rinpoche. 1986:6. He mentions that the tradition was guarded by the Siddha Urgyen-pa (1230-1309) and the third Karma-pa Rang-chung rdo-rje (b.1284), a contemporary of Bu-ston.

4]0

67

3. SURVEY OF THE KALACAKRA TEXTS AND THEIR CONTENT.

In this chapter some themes in the basic texts of Kiilacakra will be treated especially in relation to the texts about Mafijusrf and also to the problem of Time and Shambhala. The great amount of texts and teachings of the Kiilacakra Tantra cim be approached in different ways. The basic approach is textual. It is necessary to study the basic Sanskrit texts in order to have an understanding of the teachings. Another method is to study the commentaries to the basic texts, most of them in Tibetan translation or as original texts and a few existing in Sanskrit. A third method is to study the ritual and the way it is practised today in the Tibetan tradition. It must be remembered that the current practice has a Tibetan context and that it is not sure that the rituals were practised in the same way in India a thousand years ago. Apparently there also existed a tradition of practising the Kiilacakra Tantra in Burma and Indonesia. 43 ! In connection with the rituals, it is possible to study the teachings from living Tibetan lamas. My work has mainly been textual: I have attended two Kiilacakra initiations, one with Kalu Rinpoche of the Karma bKa- 'brgyud-pa tradition in Stockholm, 1982 and one with the Dalai Lama XN in Rikon 1985. They have given me a valuable insight into the living tradition, but have not been used in a significant way in the dissertation.

3.1. THE BASIC TEXTS TREATING THE KALACAKRA TANTRA. 1. The Paramiidibuddha; the lost millatantra, which according to internal tradition contained 12,000 verses, and now only can be found in one small part, the Sekkodesa 432 and

For Kiilacakra in Burma see Ray. 1936:37-39. Ray describes an inscription from 1442 in Taungdwin in upper Burma where Kiilacakra texts are mentioned. This means that these teachings must have been known and practiced in Burma. The two texts which are mentioned are the Mahiikiilacakka (PaJi) and it's {ikii. This could actually refer to the Paramiidibuddha root Kiilacakra text and it commentary, otherwise they would have been called the laghutantra and its commentary. Tiiraniitha also mentions that the Kiilacakra texts were known in the kingdoms of Pagan and Pegu. Kiilacakra in Indonesia has been discussed since it became known that one of the introducers of Kiilacakra eventually came from Java or "from the land in the southern ocean". It was PilJ40 iiciirya or bSod snyoms-pa (Newman. 1985:72 and Newman. I 987a:97-99). Ariane Macdonald argues for the eventual existence of another Dhiinyakataka situated in Borobudur"in Java (Macdonald. 1970:206-210). See also Nihom. 1994:12,71,97, who actually does not hold an independant position on the existence of the Kiilacakra in Indonesia, but quotes Ruegg. 1981:217-219 and Ruegg. 1984:374. Ruegg believes that PailJ4apiitika (or PilJ4o) may be the author of the Sri-Kiilacakra-garbhiilaf!Zkiirasiidhana-niima (Toh.1365, P .2081) and thus implies the existence of Kiilacakra in Indonesia. 432 The Sanskrit text has not been found, but a reconstruction of the Sanskrit text has been made by R. Gnoli in Orofino. 1994, which also contains an edition of the Tibetan text and a translation of the whole text into Italian. Peking 7, Toh. 365. 431

68

through scattered citations in other texts especially the Vimalaprabhii cormnentary.433 The text is supposed to be written by the king Sucandra of Shambhala 434 who listened to the Buddha's preach!ng of the text. Consequently, it was supposedly written during the lifetime of Buddha Siikyamuni, at"the later part of his life. The text was then, according to its own tradition, brought to Shambhala and guarded there for over 1400 years until it was possibly brought to India, probab~y at the end of the 10th century A.D. . 2. The Paramiidibuddhoddhrta Srf Kiilacakra-niima-tantra-riija (the laghutantra) (KCT) contains 1,048 verses. I have mainly used for the Sanskrit Baneljee 1985 and the Vimalaprabha editions from the Central Institute of Higher Tibetan Studies in Varanasi, edited by Samdhong Rinpoche, where the KCT is included. Tibetan translations: Toh.362 and 1346, P.4. This text is supposed to be written by a successor of Sucandra as king of Shambhala called Maiijusrf-Yasas as an abbreviation of the Paramiidibuddha. This text, together with the VP, defmitely appeared in India at the end of the 10th century and is now the extant surviving Kiilacakra basic text. The dating of the text is uncertain, but the mention of Islam, Muharmned and Mecka and the fact that the Muslims were the great enemies (mlecchas) indicates a date after or during the Muslim invasions of India, beginning towards the end of the 10th century. 3. The Vimalaprabhii (VP); the tflm in 12,000 lines. The Sanskrit editions from Varanasi: Vimalaprabhatlka Vol.l. 1986, Vol.2. 1994, Vol.3. 1994. Tibetan translations: Toh.845 and 1347, P.2064. There is also said to have existed a Vimalaprabhii containing 60,000 lines. 435 The extant VP was written by a later king of Shambhala called PUIJrf.arika. In India and Tibet, it has always been transferred together with the KCT. The text Srf Kiilacakra (KCT) is supposed to be an abbreviated version, laghutantra, of a much longer malatantra that was preached by Siikyamuni Buddha at Dhiinyakataka stupa 436 in south India, in the presence of king Sucandra of Shambhala. The latter is the Tibetan way of spelling that has become the best known. It has been very difficult to locate, if it exists at all as a concrete geographical unit. Bembaum and Newman have proposed the Koeho kingdom of the Uighurs in Turkestan. 437 Orofino has expressed some scepticism at this proposition but gives no alternative interpretation. 438 The latest investigation of the location of Shambhala was done by Andresen in her dissertation and she proposed a location for Shambhala in the Khotanese kingdom before its extinction by the muslims around the year 1000. 439 Hartzell places the kingdom Shambhala in Kashmir.44o He argues well for The most comprehensive investigation ofthe relation between these texts has been done by John Newman (Newman. 1987:93-102). 434 I use here the spelling Shambhala as used in the Tibetan tradition. In the original Sanskrit texts it is written Sambhala. 435 VP vaLl. 1986:3, line 17-20; Newman. 1987a:227. 436 The location of this sliipa is near the town of Amaravati, Guntur district, in Andhra Pradesh. (Macdonald. 1970:205; Hoffmann. 1973:139-140; Newman. 1985:53,83; Newman. 1987a:71-73). Macdonald also leaves the field open for the existence of another Dhiinyakaraka that could be identified with the Borobudur on the island ofJava (Macdonald. 1970:206-210). 437 Bernbaum. 1980:44-46; Newman. 1985:83-84; Newman. 1987a:75. Newman. 1996:486-487. Hartzell. 1997. 438 Orofino. 1994:11-12. 439 Andresen. 1997:82-93. 433

69

his theory and it is possible that the texts were really written in India and not in a Shamb_ hala kingdom situated in Central Asia. In any case, the basic Indian origin of the Kiilacakra Tantra is quite clear' from the ideological context, even if it was written outside of India proper. In Shambhala, Sucandra is supposed to have written the original commentary called Vimalaprabhii, much longer than the one now extant. The seventh king after Sucandra, Yasas wrote a condensed version, our KCT, and his successor, PU1:zejarika, wrote the present Vimalaprabhii commentary. The actual dating of these texts is very difficult, but we have a date in the KCT 1.27., which has been calculated recently by Newman to 1024/25 or 1026/27441 and by Orofmo to 1026442 so the text must have existed at that time. Newman actually believes that the texts were compiled at that date. Also, it is written in 1.26., that Yasas would appear in Shambhala 100 years before Islam was introduced to Mecka (which should mean about 530).443 All this is told in the form of prophecies made by Buddha Siikyamuni. We also know that these two texts were translated to Tibetan more or less at that time, around the middle of the 11 th century. The Kiilacakra texts are found in the Tibetan Buddhist canon. As it has several editions, the numbering of the texts varies. In this dissertation, I have mainly used the Derge edition and the numbers of the Catalogue of this edition made at Tohoku University, Sendai, Japan in 1934. The same numbering has been adopted in the DharmaINyingma edition from Berkeley, California, which is the edition that I normally used. 444 Occasionally I used the Peking edition and the catalogue published by Otani university, but normally I had limited access to that edition. It is interesting to note the position of the Kiilacakra texts in the canon, showing the importance given to this teaching by the editors of the canon. The very fIrst text in the Tantric section of the canon is the Toh. 360 Manjusryniinasattvasya paramiirthaniimasahgfti (MNS). As I will later show, this text is of utter importance to the Kiilacakra Tantra and it would be logical to fInd it in this place. The MNS is basic to the concept of Adibuddha and is therefore of particular interest to this dissertation. In the bKa'- 'gyur fIve texts that are said to be the words of Buddha Siikyamuni can be found. 445 In the bsTan- 'gyur there are 47 commentary texts as follows: Toh. 361, P.3 - Sekkodesa, 7 fols., transl. by Somaniitha and Shes-rab grags. This text is said to be an extract from the lost root-Kiilacakra-tantra, Paramiidibuddha (P), 7 fol.

Hartzell. 1997 :991-10 0 2 . . Vimalaprabhiillka Vol.I. 1986:71. Newman. 1985:65,85 note 13; Newman. 1987a:538-39 note 14; Newman. 1987b:100 note 24 and the definitive article on this dating, Newman. 1998a; Schuh. 1973:20,121; Banetjee. 1959:60. 442 Orofino. 1994:15-16. 443 Vimalaprabballka YoU. 1986:71; Newman. 1987a:531. 444 Tohoku Catalogue. 1934 and The Nyingrna edition. 1982, 445 Toh. 1934:67-68; Catalogue of the Nyingrna edition. 1982 Vo1.3:158-159; Otani. 1985: 1-2. 440 441

70

Toh. 362, P.4 in the bKa '- 'gyur and 1346 in the bsTan- 'gyur - Paramiidibuddhoddhrta-Srfkfilacakra-niima-tantrariija (KCT), 106 fols., By Mai'ijusrf-Yasas, transl. by Somaniitha and Shes-rab-grags. This text is placed both in the bKa '- 'gyur and the bsTan- 'gyur showing the great respect given to this teac~ng. Toh. 363, P.5 - Srf-Kiilacakra-tantrottaratantra-hrdaya-niima, 14 fols., trans!. by gNyen, chung Dharma-g;ags. Toh. 364, P.6 - Srf-Kiilacakragarbha-niima-tantra, 2 fols., trans!. by Srf-Bhadrabodhi and Zla-ba'i 'od-zer Toh. 365, P.7 - SekaprakTYii, 5 fols., transl. by Samantasrf and Chos-rab. Additional commentarial material on the Kiilacakra Tantra also exists. The canonical commentaries translated into Tibetan and found in the bsTan- 'gyur have the numbers in the Tohoku Catalogue from 1348-1394. They treat different subjects found in the basic Kiilacakra texts. The most well-known is by Nii-ro-pa and treats the initiation process.446 Others are short condensations of the teachings. 447 Others are commentaries on the six-fold yoga (~acJahga_yoga).448 Astronomy and the cosmology of the Kiilacakra are also commented on. The texts are the following. Toh. 845, P.2064 in the bKa '- 'gyur and 1347 in the bsTan- 'gyur. Vimalaprabhii-niimamillatantriinusiirilJf-dviidasasiihasrikii-laghu-kiilacakra-tantra-riija-!fkii, 469 fols., by Avalokitesvara, trans!. by Somaniitha and Shes-rab-grags. 449 This is the great commentary Vimalaprabhii which is, unique for a commentary, placed in the bKa '- 'gyur and the bsTan- 'gyur. This emphasizes the requirement to also study the . commentary which has always been transmitted together with the laghutantra KCT. The following information was obtained from the Tohoku catalogue, the catalogue of the Nyingma edition and the Otani catalogue ofthe Peking edition. 450 The titles and authors of the commentaries in the bsTan- 'gyur are given in Appendix 3 at the end ofthe present work. 451 There also exists a great number of Tibetan commentaries on the Kiilacakra tantra, especially the ones by Bu-ston and mKhas-grub-rje and also Tiiraniitha, which I have used in the present work. 452 One of the more important commentaries is the work of Mi-pham on the Kiilacakra from the 19th century.453 Considering the great amount of material available, I have chosen to work with the basic texts the laghutantra Srf-Kiilacakra-tantra-riija and the main commentary Vimala-

Toh. 1353, Sekoddesa-tIka. Toh.1348, 1350. 44' Toh.1364, 1367, 1368, 1372, 1373, 1374, 1375, 1387, 1388 and 1390. 44' Toh. 1934:142 and 216; Catalogue of the Nyingma ed. 1982 voI.3:160-161. 450 Toh. 1934:216-224; Catalogue ofthe Nyingma ed. 1982 voI.3:160-187; Otani. 1985:175-182. 451 See Appendix 3. 452 See Bu-ston. I 965abcde; mKhas-grub-Ije. 1983; rJe blo-gros chos-skyong. 1983; Zhang-zhung Chos dbang grags-pa. 1983; Tiiranatha 1983; Dol-po-pa. 1992. '" Mi-pham. 1971. 446

447

71

prabha. Excepting the doctoral dissertation by Newman454 and the unpublished dissertation by B.Banerjee in Gennan,455 none of these texts were translated when I initiated this project. Newman has, in his dissertation, translated parts of the first chapter Lokadhatupatala, KCT I: 1-27 and 128-170 together with the commentary Vimalaprabha. A major portion of his translation is the long introduction to the whole of the Kalacakra system placed in the first chapter of the VP. This introduction is of great importance for understanding this very complicated tantric system. He also wrote commentaries and an introduction to the whole of the Kalacakra which still today is basic for the further study of this tantra. Unfortunately, it has not been published in book-fonn. Banerjee translated the whole of the Lokadhatupatala KCT I: 1-169 into Gennan as a doctoral dissertation for Helmut Hoffmann. He did not translate the VP, butmade his own notes and commentaries to the text. The dissertation is of value and shows his great knowledge of the Indian culture. It has not been published. Wallace456 translated the whole of chapter II, the Adhyatmapatala, of the KCT and the commentary Vimalaprabhii. It is, together with Newman's translation, one of the most useful. It is not really possible to study the KCT without the basic commentary and consequently, these authors have made great contributions to the understanding of the Kalacakra Tantra. In Wallace's later work, she also studied, translated and refered to a great number of verses from the whole of the KCT and VP, especially from the 5th chapter, Jilana-parala. Andresen457 translated the third chapter, Abhi~ekapatala, and wrote at length about the general ideas in the Kalacakra Tantra. The value of the translation is limited due to her not translating the accompaning Vimalaprabha commentary. The verses without commentary are many times very difficult to understand. Hartzell458 has translated the whole of chapter five, the Jilanapata1a, of the KCT and the commentary VP. His dissertation is very voluminous and treats the whole complex of the Anuttara-yoga-tantras or the Yoginf-tantras. The Kalacakra is one of the tantras that he has investigated. Stril_Rever459 translated the whole of chapter two, the Adhyatma-pata1a, into French. It is not the first translation into an occidental language, as is claimed in her book, as Wallace's translation was published five years earlier. However, the translation appears to be good and represents the living Tibetan tradition of Kalacakra. To sum up the situation concerning the translation of the two basic texts Sri Kalacakra-tantra-raja (KCT) and the Vimalaprabha (VP): KCT and VP to chapter I, the Lok:adhiitu-pata1a, have been partly translated by Newman. The KCT has been completely translated by Banerjee into Gennan. KCT and VP to chapter II, the Adhyatma-pata1a, have been completely translated into English by Wallace and into French by Stril-Rever. 454

Newman. 1987a. Newman has translated KCT I: 1-27 and 128-170 together with the commentary,

Vimalaprabhii. BaneIjee. 1959. Baneljee has translated KCT I:I-169. 456 WaJJace. 1995 and WaJJace 2001. 457 Andresen. 1997. 458 Hartzell. 1997. This dissertation reached me late and has not been used to a great extent. 459 Stril-Rever. 2000. 455

72

KCT, chapter III, the Abhi~eka-pa!ala, has been translated by Andresen without the VP. KCT and VP of chapter IV have not been translated, but Wallace has translated and summarized some verses (2001). KCT and VP of chapter V have been translated partly by Hartzell and some verses by Wallace (2001). According to Hartzell, Wallace has also translated the fourth chapter, although it is not published. Hartzell himself has translated all of the fifth chapter, although it was not published in his dissertation. Gnoli has written on the Paramii~ara in Italian. 460

3.2. SOME REMARKS ON THE CONTENT OF THE SRI-KALACAKRATANTRA-RAJA AND THE VIMALAPRABHA..

Intending to approach the texts belonging to the Kiilacakra tantric system, at first one becomes bewildered at the mass of texts available either in original Sanskrit or in Tibetan commentaries and the translation of Sanskrit commentaries in the bsTan- 'gyur. In reading the basic texts of the system, one sometimes encounters unsurmountable difficulties in translating even single verses. Many times the commentary is of little help as many difficult passages are not commented upon. It is evident that these texts are meant as an aid to understand what is also taught as a living, oral tradition, so it is easy to understand why these texts have been resisting translation into western languages for a long time. To make an attempt to describe something of the ideas and practices put forward in the tantra, I will start by making a few remarks on the content of the basic text extant today, the Sri-Kiilacakra-tantra-riija (Toh.362) (I use the abbreviation KCT or Sri Kiilacakra) and its commentary Vimalaprabhii (VP). The full title of the text is: Paramiidibuddhoddhrtasrikiilacakra-niima-tantrariija, "The king of tantra, Sri Kiilacakra, drawn out from the Paramiidibuddha," which means that it has its source in the Mula-Kiilacakra-tantra called Paramiidibuddha, which according to tradition was written by king Sucandra of Shambhala. The KCT was written by the seventh king of Shambhala, king Yasas who is said to have made a condensed version of the Paramiidibuddha. The Paramiidibuddha text is said to have contained 12,000 verses and from this the laghutantra is an abbreviation that contains 1,048 verses. 461 In contrast to many other tantras, the KCT has only one canonical commentary, the Vimalaprabhii, in 12,000 lines, written by the successor to king Yasas called PUIJif.arika. Furthermore, in the Vimalaprabhii it is written: "The 60,000 line commentary written by Sucandra revealed the meaning of all the vehicles.,,462 Thus, there is also said to have existed a root-Vimalaprabhii written as a commentary to the root-tantra, but from this text we

Hartzell. 1997:970; Gnoli 1997. This problem has been best discussed by John Newman (Newman. 1987b:93-102). For the sources see Yimalaprabha vol. I. 1986:21-22, Newman. 1987a:288-89 and Bu-ston. 1965a:345. 462 Vimalaprabha vol.I. 1986:3, line 17-20. Newman. 1987a:227. 460

'61

73

have no citations like those from the Miila-tantra (root-tantra); so its eventual existence is even more uncertain.

3.2.1. Kalacakra and its relation to the Maiijusri-niima-saJigiti.

The following is an analysis of a quotation from the Vima/aprabhii which has played a certain role in the earlier research op. the Kiilacakra tantric system. This is done to show the importance of the text Mafijusrf-niima-saizgfti for the Kiilacakra texts. Sanskrit: ata ye paramlidibuddhan na janlinti te nlimasahgftin na janlinti! ye nlimasahgflin najanlinti te vajradharajiilinakiiya najanlinti! ye vajradharajiilinakiiyan najanlinti te mantraylinaTfl najanlinti! ye mantraylinaTfl najanlinti te saTflSlirina/:l sarve ·vajradharabhagavata mlirgarahitli/:l / evaTfl paramlidibuddhaTfl mak,lirthibhi/:l sacchi,yai/:l sratavyaTfl sadgurUl:zli desayitavyam iii. 1'63 Therefore, those who do not know the Paramlidibuddha464 do not know the Nlimasahgfti. 465 Those who do not know the Nlimasahgfli do not know thejiilinakiiya of Vajradhara. Those who do not know thejiilinakiiya (wisdom body) of Vajradhara, do not know the Mantraylina. Those who do not know the Mantraylina are ail in and of samslira, separated from the path of Bhagavlin Vajradhara. Thus the Paramlidibuddha should be taught by excellent gurus and listened to by excellent disciples who strive for liberation. As early as in 1833, Csoma de Koros published a translation of this text, although without mowing that it was from the Vima/aprabhii. He quotes it from the famous 16th century Tibetan historian, Padmadkar-po, 466 who tells the story about when one of the main line463 Vimalaprabhii voU, chapt.I,subchapter 6.2., p.52. For the Tibetan translation see Bu-ston. 1965a:419,7420,2 and The Nying-ma edition (Derge), Toh.845, 1347. 464 Csoma de Koros interpretated this word as the chief first Buddha" and gives it thereby a more or less theistic definition (Csoma de Koros. 1833 :58), while it is obvious that in this context Paramiidibuddha is the name of the Kiilacakra lost root tantra and is compared to the Niimasaflgiti which also is a name for the text Maiijusriniimasaflgiti (Toh.361). 465 Here must be meant the text Manjusrfi-jniinasattvasya-paramiirtha-niimasaflgiti, P.2 and Toh.360. That this text has a special relation to the Kiilacakra system is also shown by the fact that it stands first in the rGyud (Tantra) section of the bKa '- 'gyur , just before the Kiilacakra texts. Its commentaries are also placed just after all the commentaries on the Kiilacakra in the bsTan- 'gyur (p.2111-2116, Toh. 1395-1490). Among these commentaries, there is interestingly enough one written by king PuTJ4arika of Sambhala who wrote the Vimalaprabhii commentary. Even the name· of the commentary is Arya-manjusri-niimasaflgiti-rikaVimalaprabhii (Toh.1398, P.2114), which also shows the close relation between the two sets of texts. There are also various quotations in the Vimalaprabhii (Vimalaprabhii voU, VP voLI. 1986:18; Newman. 1987a:276-78. More on this connection between the texts can be found in Wayman. 1985:7-8 and Davidson. 1981:12-15. . 466 Padma-dkar-po; Chos- 'byung, fo1.68; Csoma de Koros. 1833:57-59 repro 1911:21-23.

74

age-holders of the Kalacakra, th~ Indian siddha Naropa (or Na4o,. Na4apada or Kalacakrapada the Younger) wrote It over the door of Nalanda monastery ill order to provoke a debate on the teachings that he had acquired and that obviously were new to the monk community of Nalanda. In these later chos- 'byungs (religious histories) of Kiilacakra it is told that Naropa won the debate and the community accepted the new set of teachings. Later, the same passage has been translated by Helmut Hoffmann, John Newman and David Reigle. 467 There is an interesting alteration by Padma dkar-po in the first two lines of the quotation. He writes Kalacakra instead of Namasangfti and therefore Csoma de Koros translates the passage as follows: "He, that does not know the chief first Buddha, (Adibuddha), knows not the circle oftime (Kalacakra). He that does not know the circle of time, does not know the exact enumeration of divine attributes (namasangfti)." 468 The rest of the text seems to be identical with the Vimalaprabhii. Why did Padma dkar-po make this interpolation? A possible interpretation is that in the 16th century the concept of Kiilacakra was more important than Adibuddha, although it should have been obvious for a Tibetan commentator that the word Paramadibuddha in this context represents the malatantra text. As a result, this text has been published several times but not sufficiently analysed, something that is presented below. 469 First, the Paramadibuddha in the Vimalaprabha context, is the name of the lost Mulatantra. The quotation is found in the 6th uddesa of the Vimalaprabha and is called "A summary of the mandalas, abhi~ekas and so forth," and it comments on verse I: 2 of the Srf Kalacakra where king Sucandra requests Buddha Siikyamuni to explain all the subjects found in the tantra. The citation in question is placed at the very end of this subchapter; just before it stands the following lines: "This process of purification that gives the mahamudra siddhi,470 that is manifest in the Paramadibuddha, was written down in a book. Knowing the superior aspirations of the minds of the fortunate sentient beings north of the SUa River, the Bhagavan taught it and VajrapaIJ-147 I wrote it down in a book. The Bhagavan made the Namasangfti authoritative, and since it frees all beings from doubt, he rightly taught VajrapalJ-i the definitive meaning of all the mantra systems of the Mantrayana from the Namasangfti.,,472 Before this quotation, the teachings on "the Fourth prajfia-jfiana (wisdomdiscriminative wisdom),473 the mahamudra meditation and the path of smoke and so forth" were treated. 474 These teachings were not revealed by all the mula- and laghutantras except for the Kalacakra root and abridged Tantras. So these two tantras have a very special posi467 Hoffmann. 1967:40; Newman. 1987b:93; Newman. 1985:68-69; Newman. 1987a:412; Reigle. 1986: back cover. My translation is based on Newman and Reigle, with some small changes. 468 Csoma de Kiiriis. 1833:58; (1911 :21-22). 469 Lately a new attempt to analyse the influence of the MNS on the Kalacakra Tantra has been made by Vesna A. Wallace (Wallace. 2001 :18-21). 470 The siddhis (special powers) of mahiimadra (the tantric technique of mahiimiidra). For the meaning of this word see Newman. 1987a:231, 280-81,287,367,373,410,411. 471 From the context, it is clear that Bhagaviin stands forSakyamuni Buddha and Vajrapiil;!i for the king Sucandra VajrapiilJi is the bodhisattva belonging to theAk~obhya family among the fivejinas. 472 Vimalaprabhii YoU. 1986:52; Bu-ston. 1965a:419; Newman. 1987a:411-12. 473 Newman. 1987a:231,279,280,287,410. The fourth state is the state of bliss that goes beyond the normal bliss. It is a state of ecstasy sometimes described in erotic terms. 474 Newman. 1987a:41O.

75

tion. It is consequently explicitly written that Sucandra WTotedown the Paramiidibuddha copying the words of Siikyamuni Buddha, who in his turn based the teachings of Kiilacakra on the [Mafijusrf]-niima-sangfti. Actually the dtifmitive meaning (skt. nftiirtha) of·all the teachings in the Mantrayiina is contained in the Niima-sangfti. The importance of the Niima-sangfti has consequently been very great. Especially in Tibet, it seems that it Was leamt by heart by almost every fully ordained monk. 475 The famous verse on the Adibuddha in the Niima-sangfti is:

aniidinidhano buddha iidibuddho niranvaya/:l I jiiiinaikacak~ur amalo 47. jiiiinamilrtis tathgata/:l 1110011 477

Without begi1ll1ing or end, he is Buddha, iidibuddha without causal c01ll1ection. Stainless with his unique eye of wisdom, he is embodied wisdom, the Tathiigata.

Basic ideas from this verse can be found in the Vimalaprabhii. 478 Even what seems to be a clear quotation of the first line can be found in the commentary on the first verse of the first chapter of the KCT,479 and even in this case of a citation word by word, the Tibetan uses rigs-med for niranvaya. The word niranvaya480 "unco1ll1ected, without causal connection, without relation" (tib. rigs-med) is used at several places _in the Vimalaprabhii with that meaning. In the Nama-sangiti it seems to be an idea of an Adibuddha outside of all causality. In the Vimalaprabhii, we can not find that meaning of Adibuddha expressed so clearly, one can draw this conclusion from other characteristics of the Adibuddha, but it is not so clear. So, the change in meaning of the word niranvaya is very interesting. This word is specifically used for the Adibuddha at one place:

Davidson. 1981 :14. Toh.360, P.2. Davidson. 1981 :30, inc!. Note95 and p.57 (v.lOO); Wayman. 1985:93 (chapt.8, v.24) 477 The translation "without causal connection" for the Sanskrit "niranvaya" is used here by Davidson with guidance from the Tibetan translation rgyu-med = "without cause". Wayman translates it as "without preceding cause". I opted for the more general translation by Davidson, as rgyu med is not only "without preceding cause" but also "spontaneous, without any actual cause." The sanskrit word niranvaya actually means, "having no offspring, childless; unconnected, unrelated, without retinue, unaccompanied." (Monier-Williams). The word does not occur in the Mahavyutpatti dictionary, which could mean that the Niima-sangiti was not included in the first set of Buddhist texts translated into Tibetan in the 8111 or 9'h century when the Mahavyutpatti was compiled. The word Adibuddha does 110t either occur, something that indicates that there did not exist any texts treating the concept of Adibuddha. 478 Vimalaprabhii Vo!.l. 1986:18, Newman. 1987a:277; Vimalaprabhii YoU. 1986:12, Newman. 1987a:248,270; Vimalaprabhii VoI.I. 1986:17, Newman. 1987a: 274,276. The Sanskrit word niranvaya is used here. It seems that here the Tibetan translators have opted for the word as "unaccompanied or unconnected ", which leads to Newman's translation "without" partiality". The Tibetan word used in the Vimalaprabhii is rigs-med which means "without family or lineage, or sort or kind." It appears that the second meaning was chosen for by Newman as it is possible to say that if if something is without any different kind, so it is withoutpartiaJity. A further translation of the word is given in Newman. 2001:589 as "without relation". It is in connection with an analysis of the concept of vajrayoga where Newman states that vajrayoga is "without relation" (niranvaya) as it pervades everything. Therefore it cannot be localized within mundane existence or 47;

47.

nirvana. 47' Vi~alaprabhii V~!.l. 1986:32, line 20-21; Newman. 1987a:327. 480

Bu-ston. 1965a:369. Bu-ston uses rigs-med in his commentary.

76

"He [the Bhagaviin Siikyamuni Buddha] is the sole cakravartin of the three realms, the Paramiidibuddha without causal connection (skt. niranvaya, tib. rigs-med). He is the Bha-I kr ,,481 gaviin Ka ac~ ~'.. .. This cltanon

IS

used m the context of explammg when the Buddha taught the

Kiilacakra tantra t.? Sucandra, so it is a very important definition of Adibuddha. However, it is stressed that Adibuddha is non-dual, not that he is outside the scope of causality. On the contrary, in several places it is written that he is the progenitor of the jinas, or father of thejinas. Could this be a conscious change of meaning between the two texts, to stress that Adibuddha in fact is, to a degree, more of an active principle in the Kiilacakra than as Maftjusrf in the Niima-sangiti? There are quotations from the Niima-sangfti in the fifth chapter of the Vimalaprabhii which are very interesting in this regard.

Other connections between the two sets of teaching can also be found. For example, VajrapiiIJi as Vajradhara is the one that is addressed in the very first verse of the MNS.482 VajrapiiIJi also has a great role in the K~lacakra, as incarnated in the king Sucandra of Sambhala. Vajradhara is of course the Adibuddha in the Kiilacakra, although the name Vajradhara is not often used for Adibuddha in this connection. Mafijusrf is also incarnated in king Yasas of Sambhala who wrote the Kiilacakra laghutantra. At another place in the Vimalaprabhii, it is also said" the Paramadibuddha (the mulatantra) is embraced by the Niima-sangfti that makes evident the jfiiinakiiya of Vajradhara.,,483 Consequently, the dependance of the Kiilacakra texts on the Niima-sangfti is quite open and evident. Therefore,

a change in the interpretation of a key-word is important. In the Vimalaprabhii commentary to KCT V:89, the same characteristic is given to Adibuddha: catu~kotivinirmuktaf!! natvii kiiyaf!! mahiisukham II uddhrtaf!! manjuvajreJ:!a iidibuddhiin niranvayiit I lak~anaf!! buddhakiiyiiniif!! caturJ:!iif!! tad vitanyate 1184

Tib. for line 2 above: Dang-po 'i sangs-rgyas rigs-med las I jam-pa 'i rdo-rjes rab-phyung-ba /485

After having paid respect to the Mahiisukhakiiya which is beyond inherent existence and [the statement] that something is, is not, both is and is not and neither is or is not, drawn out from the A.dibuddha without parts (unconnected, without relation) by Manjuvajra, the characteristics of the four bodies of Buddha are to be explained.

481 Vimalaprabha Vol.L 1986:12, line 5-8; Bu-ston. 1965a:317,line7; Newman. 1987a:245. See this work, p.106. '82 Davidson. 1981:18 and note 52. He makes a good summary of the relationship between Vajrapiil}i and

Vajradhara.

'83 Vima1aprabha Vo1.I. 1986:12; Newman. 1987a:246.

'84 Vimalaprabhii VoI.III. 1994:15-17.

Vimalaprabhii in Tibetan as edited and commented upon by Bu-ston. 1965c:I-294 entitled: "Ye-ies-kyi lel:zul:zi i:zgrel mchan: Annotations on the Jiiiinapatala." This quotation is from p.80.

485

77

This is a very interesting verse in several ways and-will be further treated below (p.154). It should be noted that Mafijuvajra is another name for Mafijusrf-yasas, and in this context it is said that he is a sort of first emanation from the Adibuddha who makes evident the four bodies of the Buddha from the Adibuddha (the miila-tantra), who itself seems to be inactive and identified with the highest of the four bodies naIJled, only in this context, Mahiisukhakiiya. Later in this part of the Vimalaprabhii, which treats more specifically the four bodies in the Kiilacakra, it is called Sahajakiiya or Suddhakiiya. 486 In order to continue the analysis of the quotation from the Vimalaprabha it is also said that it is not possible to know the Mantrayiina without knowing the jfiiinakiiya of Va~ jradhara. Jfiiinakiiya in this context might stand for Mafijusrf as here it is question about -the Mafijuirf-niima-saflgfti. Jfiiinakiiya can also in the Vimalaprabhii stand for Buddha Siikyamuni, as in the very first verse of the KCT. In the commentary to this verse there is a long interpretation of the word jfiiinakiiya, based only on two other verses from the MNS.487 The conclusion is that the jfiiinakiiya is the Perfect Buddha, the Bhagaviin, which means that it is a way of denominating a Buddha, and it can also stand as the "wisdombody" of the Adibuddha. 488 Consequently, the Niima-saflgfti is perhaps even more important for the doctrines in the Kiilacakra than has previously been stressed, especially for the concept of Adibuddha. As for the concept of Vajradhara in the MNS, of course in later tantric literature it stands for Adibuddha, but in this earlier_ context that is not so evident. In verse 40 of the MNS, Mafijusrf is actually called Mahavajradhara, and Vajradhara is also a name for Vajrapii7J.i with reference to wisdom (jfiiina).489 On the other hand, when PU7J.rf.arika here speaks of Vajradhara in the Vimalaprabhii, it is obvious from the introductory parts of this text that Vajradhara is another way of denoting the Adibuddha concept. 490 The conclusion of the foregoing then might be that the "jfiiinakiiya of Vajradhara" signifies Mafijusrf who is the "wisdom-body" of Adibuddha.

3.2.2. The concept of Time (kala) in the Kalacakra-tantra.

Kiilacakra means "the wheel oftime" and important parts of the tantra treat Time as a fundamental concept. Principally in the first chapter on the outer world, of the laghu-tantra now existing, the Srf Kiilacakra-niima-tantra-riija (KCT), on the outer world (LokadhiituVimalaprabhii Vol.III, the chapter on the four bodies. Tibetan: Bu-ston. 1965c:80-101. This is the commentary to the verses in the KCT V:89-126 which is a very interesting treaty on the concept of the four bodies in the Kiilacakra system. This part will be treated more in detail in chapter 5. 487 Toh.360. Nyingma ed. 360. MaFijusri-niima-sangfli verses 87 and 99. Davidson. 1981 :29>30,59. 488 VimalaprabhiiVol.L 1986:38-39; Newman. 1987a:349-352. 489 Davidson. 1981:18, note 52. 490 Vimalaprabhii 1.1. in VP vol.L 1986:4; Newman. 1987a:229; Vima1aprabhii 1.2 in VP vol.L 1986:12; Newman. 1987a:246; Vimalaprabhii 1.2 in VP voI.I. 1986:18; Newman. 1987a:276-277 and Vimalaprabhii 1.2 in VP vol.L 1986:29; Newman. 1987a:313. Especially in the last mentioned place, it is evident that Vajradhara denotes Adibuddha: "He [Buddha Siikyamunil explained that they will obtain mahiimiidra that is governed by the supreme unchanging bliss (paramiilqarasukha) of Bhagaviin Vajradhara." 486

78

patala), the division of time in small parts is treated. It is also written that the world e~erges out of Time (Kala). KCT 1:4 follows: kaliic chanyeeu viiyujvalanajaladharii dVfpasaila/:! samudrii/:! rksiilJindvarkatiiriigragaJ;areayo devabhatii§ ca niiga/:! 1 iiryagyoni§ caturdhii vividhamahitale miirakti§ ca niirakti§ ca sambhatii/:! sanyamadhye lavalJam ivajale tv alJ4ajii§ ciilJq.amadhye 11411 Because oftime (ktiliit), from the voids (sanyeeu)49Is originate wind, fire, water, the earth; the continents, mountains, and oceans; the constellations, the sun, the moon, the host of star-planets, and the sages; gods, bhatas, and niigas; animals that have four types of birthplace; humans and hell beings also, on the manifold earth and below - originate in the middle of void (Sanyamadhye), like salt in water, and the egg-born in the middle of an egg.492 This verse gives the basic idea of MIa as being the force behind the origin of the universe. In the Vimalaprabhii, it is spoken of: "the force of the Time of [Bu-ston: the cosmos' birth and] origination.,,493 The cosmos originated by the force of Time behind the five s!7nyas, who in their turn are at the origin of the "wind" (skt. vayu; tib. rlung) and the other elements. So, kala is not really deified as a sort of "time-god" which is the case in some of the schools of Kalavada in ancient India. 494 There is one hymn in the Atharvaveda that provide some interesting ideas about Time; it is said: • " .. all the beings (worlds) are his wheels (cakras). With seven wheels does this Time ride ....... . Time, the first god, hastens onwards. Time begot yonder heaven, Time also (begot) these worlds .... Time created the earth.:.".495 Here Kala is combined with the wheel (cakra), he has all the beings as his wheels, he rides on seven wheels and he is the first god and also begot the worlds. These ideas are somewhat similar to the ideas in the Kalacakra about Kala being at the origin of the cosmos. Also interesting is that the importance of the wheel (cakra). A part of the Vimalaprabha commentary to KeT V:127 contains some interesting infonnation on time. 496 The unchanging moment is designated as time and when that moTib. Dus-kyis slong-pa-roams las, skt. kalac chiinye~u. The Sanskrit has a locative on siinya and the Tibetan has an ablative (slong-pa-rnams las). From the Vimalaprabhii, it is obvious that the Tibetan is more correct. Vimalaprabhii I.l in VP vol.!. 1986:54; Bu-ston's commentary. 1965a:425; Newman. 1987:422423. 492 Banetjee. 1985:1; Newman. 1987a:419-423. Kiila is also mentioned in the KCT V:241,245. 49' Vimalaprabhii 1.1 in VP voLI. 1986:54. 494 Frauwallner. 1973:75-78. Other studies of Time in India are Schayer. 1938, Scheftelowitz. 1929 and Niyogi Balslev. 1983. 495 Frauwallner. 1973:75-76. He cites from Atharvavedasamhita XIX, 53, verses 1,2,5 and 5, according to the translation ofWintemitz. 1908: 132. ,496 Vimalaprabha, VP vol, III. 1994:61, line 19 - 62, line 20. Translated in Hartzell, 1997:1259-1261. See also below p.180-81, 491

79

ment is unveiled, it is the cakra, that is, the aggregates, constituents and bases of the world. Later, it is stated that time is, among other things, "the end of being, the leader of beings, the best supporter of the three worlds, the cause of causes ....the supreme bliss".497 Kalacakra is analysed so that time (kala) is knowledge (jfiana) and the wheel (cakra) the knowable (jfieya). The unity of these two is Kalacakra and·in that way the concept is aUinclusive. Consequently, it is shown that the concept of "time (kala)" is really behind everything in the three worlds. Mention is also made that upiiya (method) corresponds to kala (time) and ,grajfia (wisdom) to cakra (wheel) and as a consequence to the concept of Kalacakra. 98 In this connection, it is also mentioned that it is possible to see the past, future and present time while practising the supreme unchanging bliss in the sexual yoga of retention of the semen. 499 This implies that it is possible that the three times can be seen at one time. This poses the question of whether in Indian time philosophy these three times can exist at the same time and if predestination exists. This is, of course, a classical problem in India in connection with the concept of karma. Using karma it is possible to say that predestination exists. In conclusion, it seems that it is possible to see the three times at the same time. In Naropa 's Sekodde§atfka, an analysis of the word Kalacakra and consequently the concept of kala, which here means time, can be found. Also upaya, the means needed for the liberation and karU1;Zii, the universal compassion with the living creatures for the sake of which the absolute reveals itself is analysed. Cakra stands for the world and prajfia, the wisdom connected with siinya, the void. Together the two concepts are Kalacakra, the union ofprajfia and upaya which leads to the absolute, the Adibuddha. soo In the tantra there is also a system of calculation of the calendar that was subsequently generally used in Tibet after the traditional date of its introduction, 1027.50 1

3.2.3. On Shambhala and the battle between Raudra Kalkin and the barbarians in the outer and the inner. The micro/macro-perspective in the Kalacakra.

The problem of Sambhala s02 and where to place it, on the map or in the spiritual world will be treated in this chapter. As remarked by Reigle,503 the word known as Shambhala is actually written Sambhala in Sanskrit. As noted for example, in KCT 1:151 and following

VP vol. III. 1994:61, line 25 and Hartzell. 1997:1259 also in KCT V:245. See below p.l81. 499 VP vol. III. 1994:88, line 27-28; below p.l85. 500 Sekoddesat"ikii. 1941:22-23. 50) This is be~t treated in Schuh. 1973. The verses in the first chapter of the KCT treating this subject have been translated and commented upon by BaneIjee. 1959. See also the unpublished doctoral dissertation by Winfried Petri on Tibetan astronomy. 502 I use Shambhala as it is written in the Tibetan tradition of translating the Kalacakra texts. 503 Reigle. 1986. 497 498

80

verses. 504 Historically, the country has been known as Shambhala as it is the Tibetan version of the legend of Shambhala which has been known. Until recently, the Sanskrit texts were not as well known. The kings of Shambhala and the problem of an eventual influence on the Kiilacakra from Central Asia will also be commented upon. 505 The myths and thoughts about Shambhala have been greatly diffused in Tibet and even to Mongolia after the introduction of the Kiilacakra-tradition to Tibet around 1030-40. Their influence extends to the present day. The Kiilacakra tradition spread to Mongolia with the conversion of the Mongols to the Tibetan form of Buddhism starting in the 14th and completed in the 1i h century. Through the theosophists and their successors, the concept of "Shamballa" has spread in the western world in later times. 506 Many theories have been made in order to place the country of Shambhala on the map. Tucci remarks that it could have. been near the river Sita, identified as the river Tarim. 507 Bernbaum was inspired, among others, by Hoffmann who saw influence from Central Asia in the Kiilacakra Tantra, presented the theory that Shambhala could be placed in the Uighur kingdom of Khocho in the Turfan Depression at the foo of the Tienshan mountains. Shambhala has been placed north of the river Sita river, which could be identified as the river Tarim. 50S Bernbaum also presented the oasis city of Khotan as a possible location of Shambhala, just north of the little known mountain range of Kunlun. 509 Some scholars have wanted to place Shambhala in India, especially in Kashmir. It could also have survived as one of the small communities in hidden valleys of the Himalaya or the Kunlun mountains. 510 Among later scholars, Newman supported the theory of placing Shambhala in the Turfan oasis based on that the Vimalaprabhii locates Shambhala north of Khotan. He also argues that by Shambhala could be meant the Khocho kingdom north of the river Tarim, which should be identified with the river Sita mentioned in the KCT. 511 Hartzell argues extensively for placing the kingdom of Shambhala in Kashmir, where there is a river that could be identified with the Sita river and also a town called Kaliipa, the name of the capital of Shambhala. His arguments are interesting and they establish that the Kiilacakra Tantra is an Indian tradition·and therefore it is doubtful to place the origin of this teaching outside of India. 512 The dominating tradition on Shambhala is the Tibetan, as Buddhism disappeared from India. There are different interpretations of Shambhala even in Tibet. As Bernbaum has remarked, perhaps the most ancient text on Shambhala, the vol.l. 1986:153. This problem has been treated most thoroughly by Bernbaum. 1980 and 1985. A survey of western scholarship was made by Bembaurn (Bernbaurn. 1985 :3-1 0). For a valuable review of Bernbaum, see Newman. 1987a:193-207. See the following for the Sanskrit text and a translation of the parts of the Vimalaprabhha that treat subjects concerning Sambhala: Vimalaprabhii Vol.I. 1986:23-30,77-78, 152-153, 154; Newman. 1987a:292-316,531-538,578-583,620-641. For the kings of Sambhala, see Reigle. 1986. For special studies of Shambhala: is Kollmar-Paulenz. 1992/93 and 1997. 5.. See for example Bailey. 1951, index. 507 Tucci. 1980 (1949):212. 508 Bernbaum. 1980:42, Bernbaum. 1985:142 and earlier in Hoffinann. 1961:125-126. S09 Bembaum 1980:43. 510 Bembaum. 1980:45-46. SII Newman. 1987a 512 Hartzell. 1997:991-1002. 504vp 50S

81

Kaliipiivatara, gives quite a different version of many stories. 513 It is probable though, that the Shambhala tradition has its origin outside the context of the Kiilacakra texts. It could be borrowed from the PuriiIJas according to Newman. In the following the tradition of the eschatological battle between the 25 th king of Shambhala and the mlecchas, barbarians identified with the Muslims, departing from the basic laghutantra-text Sri Kiilacakra-tantra-riija (KCT) and the great commentary Vimalaprabha (VP) will be treated. The commentary has a special position in this tradition and has always been taught at the same time as the KCT and also contains material apparently from the presumably lost root-tantra. Therefore, the VP commentary is as important as the laghutantra. I will concentrate on the micro/macro-cosmos perspective and how it is expressed in the texts I have worked principally with the Sanskrit texts, but also with the Tibetan translations and the translation and commentary of Newman in his dissertation, and also the work ofHoffman. 514

3.2.3.0. The information on Shambhala in verses KCT 1:150-170.

The first chapter of the KCT and the commentaries in the VP treat the "outer world". They contain a description of the outer tradition of Shambhala, the perspective of macro-cosmos. In the 2nd chapter, a corresponding treatment of the micro-cosmos perspective of the human body is found. Strangely enough, the verses in the first chapter, KCT 1:150-170, do not have a corresponding commentary in the VP. It is only said that obvious and clear and no commentary is required. This is not actually true, as, is evident from studying the text. There are few places in the KCT which are not provided with commentary in the VP and the authors intentions when not commenting on the text is difficult to imagine. Perhaps the theme was not sufficiently interesting as greater stress is put on the commentary of the inner perspective in the second chapter. It could also actually be ironic, because of the apparent difficulties of interpretating the text.

3.2. 3. b. The history of Shambhala in Sri-Kiilacakra-niima-tantra-riija, chapter 1, verses 150-170. I have here condensed the content ofthe verses KCT 150-170: Verses 150-152: First is a description of how Shambhala is placed in the Buddhist cosmological theory. In the middle of the continent, Jambudvlpa, the mountain Kaila.§a is to be found. On the right side of the mountain is Shambhala, which has ten million villages. 100,000 villages form a district. Sambhala is spelled with a simple S- in the Sanskrit origiBernbaum. 1985:112-118. Newman. 1987a:578-654 and Hoffmann. 1969:54-60. See also the later work by Newman. 1995 and Wallace. 2001:115-117. 513

l14

82

nal textS. The conclusion is that the original name was Sambhala. Interestingly enough, in the Tibetan translation the spelling "Shambhala" is already to be found. This might depend on several factors.·Perhaps later editions of the text have been changed to Sh- in the Tibetan text. Or perhaps it was written as Shambhala from the beginning, something that could be a sign of an independent Tibetan spelling of "Shambhala". This is difficult to know. Newman has communicated that probably Tibetans followed Indian pronounciation. I will follow the Tibetan tradition and write Shambhala as this is the historically used designation of this "mythic" country. Verse 153: Ten of the emanations of the Buddha are presented with the same names as the ten avatars of Vishnu. This is evidence of a strong vishnuitic influence. Then CakrapiiTJi is mentioned, identified with the king Raudra Cakrin who is the enemy of the demons who shall reign for 100 years as the 32nd of the lineage of kings in Shambhala. For the first time in the text Raudra Cakrin, who is going to fight the barbarian mlecchas, is mentioned. Verse 154: This verse is perhaps the best known in the whole of the KCT in western research. Helmut Hoffmann wrote about it in 1969 when he studied the eventual influence of Islam, Christianity and Manicheism on the Kiilacakra. 515 In this verse, a series of figures are presented who are in the service of the demonic snakes. They are Adam, Noah, Abraham, Moses, Jesus, "The white-clad one", Muhammed and MathanL Muhammed is prophesized to be born in the city of Baghdad in the country of Makha. The literary form of prophecy is current in the Kiilacakra texts as they are written as prophecies of what is going to happen, theoretically being written at the time of the Siikyamuni Buddha when he preached the Kiilacakra Tantra at the Dhiinyakataka stilpa. Muhammed and his teaching of Islam is presented as a barbaric teaching and consequently the main enemy of Buddhism. The verse has been discussed later, especially by Orofino and Newman. 516 Verse 155: The barbarians are described as killing camels, horses and cattle, boiling the meat with blood and just eating a smaIl piece. Verse 156: Here it is mentioned that the wisdom body of the Jina (jiiiinakiiya) is the Buddha Siikyamuni. It is also mentioned that the Buddha taught the teachings of the Vedas. This is another sign that the old Indian religion had a great influence on late tantric Buddhism. Verse 157: Kaliipa is described as the capital of Shambhala. The king Sucandra is going to install his successor and then seven npati (lord of men; the king) will follow. Then the first of twenty-five kalkins of the vajra-line will be Sri Yasas who is Sri MaiijuvajralMaiijusrl. He shall clarify the Kiilacakra. The author is here writing about himself, something which is possible because the whole text is written as a prophecy. In the commentary of Bu-ston twenty-five Kalkins are given. Sl7 The list is the same as in the introductory commentary of the VP to the whole KCT. Seven dharmariijas and twenty-five kalkins make thirty-two kings of Shambhala. It is interesting that the term kalkin is used here as it is a viiTJuitic term for a future ruler in the. text Kalki-puriiTJa. 518

Hoffmann. 1969172. Newman. 1987a and 1995; Orofino and Gnoli. 1994c. 517 Bu-ston. 1965a 518 See Kalki-purii1Jl1, the text in Sanskrit has been edited, but there is at present no translation into English. SIS

51'

83

Verse 159: This verse contains information about the Raudra Kallan as the 25 th king. He shall give peace to the holy men, but he shall annihilate the race of the barbarians. He is called Cakrin and shall ride on a horse with a short sword in his hand and he shall wipe out all the enemies. In the verses 160-165, the details of the fight whi.ch is going to take place at the time of the Raudra Kallan are described. Verse 160: When eight successors have been in possession of the throne in the Kalkin line in Shambhala, the barbarian dharma (mleccha"dharma) is going to be introduced in the country of Mecka (Makha). Then the great battle at the time of Raudra Kalkin is predicted. Verse 161: The Cakravartin who is going to rule at the end of this age (yuga) is treated. The ruler is coming from the city of the gods (Kaliipa) on the mountain of Kailash. He is identified as Raudra Cakrin, Rudra Cakrin or just Cakrin. He is going to defeat the barbarians with an army consisting of four parts: Rudra, Skandha, Ganendra and Hari. It should be noted here that the names of the Hindu gods are used as names of parts of the army. Both sivaites and viiflJuites are taking part in the battle. The four parts of the army are elephants, wagons, horses and infantry. Verse 162: The numerical strength of the army of the Kalkin is given in this verse. There are 90 million mountain horses. The elephants are supposed to be 400,000 in number and supposed to be drunk on wine and there are 500,000 battle carts. There will be six great annies consisting of, among others, rulers from ninety-six families. Finally, it is again said that Kalkin together with Hari and Hara shall annihilate the barbarians with this army another allusion to the fact that the battle is going to take place together with the viiflJuites, an allusion to the Hindu/Buddhist cooperation in the Kiilacakra Tantra. Verse 163: A description of how the fight is going to occur. The ferocious warriors shall defeat the barbarian horde. The lord of the elephants is going to defeat the horde of elephants. The mountain horses are going to defeat the horses from Sind. The ninety-six ruling families are going to defeat the lords of the earth. Hanumiin, the son of Mahiicandra, shall defeat Asvatthiimii with sharp weapons .. Rudra shall defeat the protector of the barbarian masters, the lord of the demons. Finally, Raudra Kalkin himself is going to defeat KrlJmati, another sign of the syncretism in these teachings. Verse 164: Here again it is stressed that Kalkin together with Hari and Hara shall defeat the barbarians in a fight with the whole army. Then they are going to the city of the gods where the Cakrin is living and there is going to be a state of paradise on earth. The commentary Padminf-niima-pafijikii states that Cakrin is Kiilacakra, something which is completely probable. 519 . Verse 165: The end of the description of the battle. It is told that when Kalkin has vanquished his enemies he shall produce perfection in the palace of the gods on the back side of the mountain Kailiisa, that is, in the capital Kaliipa. This event is placed fifty years after the fight with the barbarians. Brahmii and Suresa, the sons of the gods and the teachers of men, shall engage in the teachings and Brahmii shall be the master of men in Shdmbhala and Suresa on the earth in the southern direction.

SI9

Padmini-nama-paiijika, Toh.1350; P.2067, p.67-1-2.

84

Bu-ston states in his commentary that Brahmii and Suresa are the sons of the Cakrin and can be placed on the same level as Manjusrl and Loke§vara. 520 According to mKhas-grubrje, Loke§vara is going to be the lord south of the river SUii in the ordinary world and Manjusrfis going to be lord in the Kailiisa area.521 Verse 166: Another battle that is to take place later is described. Then the lord of three existences shall cut short the whole of the barbarian teachings. Then, after 800 years and when he has established Brahmii, he is going to the place o{happiness and after that the partition in castes is going to reappear. Consequently, humanity is going to continue to exist in good condition after the fight between Kalkin and his enemies, but after 850 years there will be a new fight with the barbarians and another good age is going to reappear on earth. This is a good example of the traditional Indian cyclic way of thinking. According to the VP, each Kalkin is going to reign 100 years and consequently the first fight is going to take place in the year 2425 and the next good age is going to last from 2475 to 3375. Then the next fight emerges and after that another good age will come on

earth. Verse 167: The ruler of gods together with the twelve rulers shall again go out and fight and destroy the barbarians. When the barbarian dharma is destroyed, the Cakrin is going to the place of bliss (mahiisukha). Brahmii and Surda are going to be behind and in front (in Shambhala). The tradition lineages from Brahmii are going to be divided into many lineages. The new fight, which is going to take place a long time after the first, is described. In these two verses it is actually expressed that there is going to be another fight between the barbarians and the Cakrin, so history will repeat itself, according to the prophecy. In verses 168-169 the cosmic periods are described: The barbarian dharma is going to last for about 1800 years. In our way of calculating time, this would mean the years around the year 2430, which fits well with the appearance of the Raudra Kalkin and the fight with the barbarian mlecchas. The information in verse 167 is even less comprehensible, as it is foretold that the mlecchadharma is going to come back after 800 years. In contrast, the Buddhadharma in verse 169 is said to last for a total of 21,600 years. The fore-going verses have described the land of Shambhala and the eschatological fight between the Raudra Kalkin and the mlecchas. They describe a coming war which is going to take place in the future on the macrocosmical level. I will now treat the verses KCT II:48-50 where the same theme is treated on the microcosmicallevel. The war is here taking place inside the body of the practitioner of Kiilacakra and is a way liberation. 3.2.3.c. The inner battle in Srf Kiilacakra-lliima-tantra-riija alld the VP, chapter II Adhyiitma-pafala, verses 48-50.

I will first present a synthesis of the basic text KCT and the commentary VP and then I will make some comments on places of importance in the text. In the verse KCT II:48 the following is found: .'20

521

Bu-ston. 1965a mKhas-grub-tje. 1983: 11 04, line 2 - 1106, line 2.

85

KCT: The mleccha-ruler is the sin (piipa). VP: .The mleccha-king Du~!a in the outer is in the body the sinful mind. KCT: KrlJmati is the producer of disaster. VP; That which in the outer is KrlJmati (bad mind) and produces suffering is in the body the unsound way of the mind. KrlJmati is here obviously not the same as Rudra (MaheSvara). In KCT ll:49 follows: KCT: A.§vatthiimii is ignorance. VP: That which in the outer was A.§vatthiimii becomes in the body the appearance of ignorance (avidya). Here A.§vatthiimii is the barbarian general who is going to be defeated by Hanumiin with sharp weapons. KCT; The whole demon-army is the four-fold army of Miira. VP: That which in the outer was the demon-army consisting of horses, elephants, wagons and infantry becomes in the inner body the four-fold army of Miira and becomes annihilated in the battle. Here the fight with the mlecchas is associated with Buddha's fight with Miira when he was tempted at the time of his liberation. KCT: The annihilation of the demon-army is the fear of existence. VP: That which in the outer among the mlecchas was the annihilation in battle, in the inner becomes the cessation of the fear of existence. To destroy the fear of existence is, of course, one of the basic teachings of Buddhism. KCT: The victorious possesses the way to liberation. VP: That which in the outer was the victory of Mahiicakrin and Kalkin, is in the body the winning of the way ofliberation. Here there is a clear comparison of the yearning for liberation in the body with the victory in battle. Liberation is a battle. KCT: The preaching of the dharma at Kailii.§a is the removal of dangers in the world. VP: That which in the outer was Mahiicakrins gift of the teaching, in one's own body becomes the removal of the desire for existence. KCT: The earth is the agglomeration of objects. VP: That which in the outer was the earth filled with resources, becomes in the inner the pure agglomeration of the elements. The elements exist also as a basis also for the body, not only for matter in the world. KCT: In the outer was the two sons of the Cakrin, Brahmii and Sure.§a. They are in the rear as well as in the front. VP: He who in the rear district (= Shambhala, on the back side of Kailii.§a) was a teacher of dharma became in a front district (= the ordinary world, on the front side of Kailii.§a) one who wishes the annihilation of the mlecchadharma (the barbarian dharma). This means that Brahmii and SureSa can move between the world of Shambhala and our ordinary world. In KCT ll:50 follows: KCT: The ruler of the world is rajas (the female menstruation blood) and bodhicitta (the male semen).

86

vp: He is Maiijusr/, the ruler of the world, the victor over the three worlds, he becomes in the own body bodhicitta and rajas and a producer of bliss; .and he takes a vow to aspire on Buddhahood. The bodhisattva Mai1jusrf has a very significant role in the Kalacakra tantra. Many of the main figures in the tantra are incarnations of Manjllsr!. Here he unites the male and female in himself. KCT: Brahma, etc., and the clans are the many pure Buddhas. Vp: In the rear district, those who belonged to the Brahma etc.-families becomes many pure Buddhas in the own body and the proper nature of the skandhas, ayatanas and dhatus. There were in Shambhala a number of clans who ruled the country and they correspond to the skandhas, etc., in the body. KCT: The fight with the mleccha-kings is actually taking place in the body of human beings. That which in the Makha district is an illusory battle with the barbarians is no battle. VP: The fight takes place in the body because the battle with the mleccha king is tied to the body, in the middle of the body and because the outer is the form of illusion and the mleccha-battle in the Makha-kingdom is not the battle. (End of the abbreviated version of the story of Shambhala) A radical conclusion is given in this verse. The fight is really in the body and is a way of liberation in the Buddhist sense. In the texts, it is obvious that the inner fight has a higher value of truth than the outer. Reading what is actually written in the text, it is said that the fight in the outer world is not going to take place. The famous eschatological battle between the king of Shambhala, the Kalkin, will not take place and instead it is a method of meditation. The inner way with liberation and illumination is superior. But in the end, because maya (the illusory world) is mentioned in this context, it is possible to imagine that what happens in the outer world indeed is an illusion, but it still has a certain value of reality. The explanation written in these verses is normally not given in the Kalacakra initiations where much stress is laid on the point that everybody who participates in the initiation is going to take part in the eschatological battle by the side of the twenty-fifth king of Shambhala, the Raudra Kalkin in the year 2325. Here it seems rather to be a method of meditation. Perhaps one could say that in the Tibetan tradition the eschatological content of the text has been stressed more than the meditative content of these verses, or perhaps the eschatological content is used in the meditational practice.

87

4. THE ADIBUDDHA CONCEPT. ITS USE AND MEANING IN THE KALACAKRA.

There exists a concept in Buddhism which is not much investigated by western scholars. This is the concept of Adibuddha. It is actually well known in Tibetan Buddhism, and is at the basis of the philosophy of the bKa '-bigyud-pa and the rNying-ma-pa, because of the Adibuddha figures of Vajradhara and Samantabhadra. They are principles from where everything has its origin. In other Buddhist countries it can also be found, especially in Japan where Mahilvajradhara can be seen as an Adibuddha figure. Also among the Newar Buddhists of Nepal the concept is known, but more in history than today. I will begin by making an overview of earlier research on the Adibuddha concept.

4.1. EARLIER RESEARCH ON THE ADIBUDDHA CONCEPT. In the year 1828, B.H. Hodgson published the first account of the Adibuddha-concept by a western scholar. 522 He presented the Adibuddha as a sort of creator god that stood above the four tathilgatas, based on the Nepalese material, especially the Svayambhu purilIJa, which was written in the 10th century following the model of the Hindu purilIJas.523 This aisvarika system of Nepal had the idea of an Adibuddha that was at the origin of the five jinas and had its origin from the "void" (sunyatil). Hodgson's articles have lately been much criticised lately and perhaps the teachings described by Hodgson were not at all as systematically theistic as he wanted them to be. 524 D. Gellner has written an article where he tried to sort out the problems concerning Hodgson's sources for the Nepalese schools of Buddhism and the Adibuddha-concept. His conclusion was that there exists a concept of Adibuddha in the Nepalese Buddhism, but that it is not as "theistic" as has been suggested. The concept is more pantheistic and can hardly be compared to the monotheistic concept of semitic religions. Consequently, the Adibuddha concept is just a part of Newar Buddhism. Many times it is nothing more than a temporal meaning of the word as the "first Buddha". The Svayambhu PurilIJa evidently had some connection with the bodhisattva Maiijusrf. The text Maiijusri-nilma-saizglti (MNS)525 was known and taught at the time of the writing of the Svayambhu purilIJa. 526 As this text (MNS) was also very important for the Killacakra system and one of the main Killacakra lineages that reached Tibet had its origin in Nepal, namely the Rva tradition from the pandit Samantasri in the last quarter of the 11 th century, one can at least put the question if the Svayambhu purilIJa did not have some influence on the Killacakra ,tradition Hodgson. 1874 (1828):35-65. de La Vallee Poussin. 1908:94-95. The latest and best summary of research on the Adibuddha has been done by Gronbo1d. (Gronbold. 1992:117-139). 523 de La Vall 88

of Adibuddha as it was practised in Tibet? The Nepalese centre for Maiijusrf is at the Manjusri-caitya near the great stupa of Svayambhii. 527 As early as in 1833 Alexander Csoma de Koros wrote a short article on the Kiilacakra Tantra where he mentioned the concept of Adibuddha in the Kiilacakra-tantra parting from the chos- 'byung by the16th century historian Padma-dkar-po.528 He translated a part of the text which actually has its origin in the Vimalaprabhii commentary,529 something that Csoma de Koros was not aware of. When in the text it is said that: "He that does not know the chief first Buddha (Adibuddha), knows not the circle of time (Kiilacakra)",s3o it is probably only a reference to the r~ot-text called Paramiidibuddha. The text does not say anything about the properties of the Adibuddha. This article and the articles by Hodgson opened the way for western researchers seeing another kind of "theistic" bUddhism.531 As Louis de la Vallee Poussin remarks, the Nepalese concept of Adibuddha did not have the tantric female counterpart, as was the normal case in Tibet. 532 To conclude, in the 19th century the Adibuddha concept was seen as more theistic than research has shown in more recent years. The article that was to remain for a long time the main reference on the Adibuddha concept was written, in 1908, by Louis de La Vallee Poussin for the Encyclopaedia of Religion and Ethics (ERE).533 In this article, he tries to analyse the four different systems of Adibuddha, the aiSvarikas of Nepal, Adibuddha in the text Kara~4avyuha, Adibuddha in the Kiilacakra and the tantric Adibuddha as VajradharalVajrasattva. He also gives a short treatment to the first mention of Adibuddha in the Buddhist texts. This is in the Mafijusri-niima-sangiti (Toh.360), where· MaFiju.M is calledAdibuddha (verse 55,100/34 The aisvarikas had, according to Hodgson, an idea about the Adibuddha as unoriginated and existing by itself (skt. svayambhil). By the power of his dhyiina ("meditation") he created the five jinas (or dhyiinibuddhas) Vairocana, A~obhya, Ratnasambhava, Amitiibha and Amoghasiddhi. This Adibuddha can be seen as a creator god and thereby an expression of a theistic thought-system. Concerning the mention of Adibuddha in the Kiira~4avyiiha535 text, is a text mainly treating Avalokitesvara, de la Vallee Poussin only remarks that there is a prose version in Tibetan translation from the 7th century that does not mention the Adibuddha. The later verse version contains a mention of Adibuddha, but then it is not before the other Mibuddha systems. 536 Moritz Winternitz took up the question some years later and reached the conclusion that there is no evidence that there existed a theistic Adibuddha

Brough. 1948:334. Csoma de Keres. 1833. " ". Vimalaprabha vol. I. 1986:52. Chapter I, subchapter 6.2. I treat this text in detail in chapter 3.2.1., p.72. 53. Csoma de Keres. 1833:58-59 and 1911 :21-22. S3\ Remusat. 1831:25,152; Burnouf.1876:468,581. 532 de La Vallee Poussin. 1908:94. 533 de La Valh!e Poussin. 1908:93-100. Sl4 Toh.360. Translated by Wayman. 1985:93 and Davidson. 1981 :30,57. I have discussed this place in chapter three . . Sl5 Kiirandavuiiha 1873. 536 .,? de La Vallee Poussin. 1908:95. 527

" S28

89

concept in India before the 10th century. The evidence' in Karal}cj,avyuha is not valid as the poetical version is much later. 537 He then finds five antecedents to the Adibuddha system. Among them, he notes'the doctrine of the three bodies and the five "Dhyiinibuddhas" (now called the five jinas) and he then tries to locate these systems doctrinally and historically. In my work with the Kiilacakra texts,s I have found the system of the four bodies very useful for analysing the Adibuddha concept. The fourth body can be seen as a link to Adibuddha, or can even be considered equal to this concept. de La Vallee Poussin does not mention the fourth body but connects the dharmakiiya with Adibuddha. In the Kiilacakra, it is definitely the fourth body that is connected with the Adibuddha. Louis de La Vallee Poussin then writes about the five jinas to whom sometimes a sixth, the former bodhisattva Vajrasattva is added. Amitiibha is sometimes the foremost of the five, otherwise the central jina is Vairocana. In the third part of his article, de La Vallee Poussin discusses the Adibuddha concept and 'makes the following statement: "Harmony was attained in various ways, either by raising to the presidency one of the five Buddhas, usually Vairochana, the god of the Zenith, or by interposing a sixth person, whether Maiijusrf, or Vajradhara, or merely the Adibuddha not otherwise defined.,,538 In the Kiilacakra can also be found a system of sixjinas, the four in each direction and two in the middle. The number six is very important in the Kiilacakra context. The body also has six cakras in the Kiilacakra system, in contrast to Hindu Tantrism where there are seven cakras. Adibuddha is calledjinapati (KCT V:243), which means that he in some way rules or is at the origin of the jinas: The word jinapati is found at least sixty times in the laghutantra (KCT). The word is used mainly for a concept transcending the fivejinas. To conclude, de La Vallee Poussin writes that the Adibuddha system consists of superimposing on the five or six Buddhas (Vajrasattva included) a Being who, however invisible and inactive he may be in principle, is nevertheless a god. A scholar who had some influence on later research,539 especially in India, is Charles Eliot who in 1921 made some comments on the Adibuddha and the Kiilacakra Tantra. After making the remark that the Kiilacakra marks the extreme point of degeneration in Buddhism, he proclaims the theory that the Kiilacakra and Adibuddha doctrines represents the last effort of Central Asian Buddhism to contend with the Muslims. Instead of denying the bases of Islam, it tried to show that monotheism could also be found in Buddhism. Furthermore, he claimed that the Adibuddha doctrine in the Kiilacakra was only a variant of the Hindu idea that the Supreme Being became male and female for the purpose of producing the universe. 54o This evaluation of these doctrines was part of a line of western research on India and Tibet that at the time was making strong statements of condemnation towards all kind of tantric practice and philosophy. Concerning Tibetan Buddhism, L.A. Waddell made similar judgements on Tibetan religion. 54l Eliot has been surpassed by modem research having access to the living Tibetan tradition in a way that was inconceivable before the exodus of Tibetan lamas from 1959 and onwards. Eliot seems to have misinterpreted Winternitz. 1920:238-239. de La Vallee Poussin. 1908:99. 539 See for example Hazra. 1986:4-5. 540 Eliot. 1921:173,386-388. 541 Waddell. 1972 (1895):131. 5J7

538

90

the basis of the Adibuddha doctrines in the Kalacakra. The philosophy of the male and female principles are quite orthodox mahayana/madhyamika philosophy of upaya and prajiia, and there is logical deduction to be found in this philosophy. An interesting article was written by Benoytosh Bhattacharyya in 1923. 542 He analysed the concept of Vajradhara in two phases. He wrote that up to the beginning of the 10th century Vajradhara was an abstract idea. He then presented the etymology of the word Vajradhara, which means "holder of the vajra (thunderbolt)". Vajra in this context can stand for Sunya, so actually Vajradhara means "holder of the Void" and in that sence to be in Nirval}a. Consequently, in order to be a Vajradhara one must have reached the goal in Buddhist meditation, the Void (Sunyata) or Nirval}a. Vajradhara did not have a form. He had reached the formless realms beyond the Akani~rha heaven where the jinas are dwelling. Bhattacharyya then stated that the concept of Vajradhara changed with the KaZacakra Tantra in the 10th century and also with the appearance of the Svayambhu Pural}a at about the same time. Then he quotes the famous place in the VimaZaprabhii where it quotes what Tilopa wrote about KaZacakra over the door in the NaZanda monastery.543 Bhattacharyya also published an important book that successfully treated the iconography.544 Carelli summarized the arguments of Naropa on the Adibuddha in his edition of the Sekoddesarfkti. The Adibuddha is the absolute itself, no more a manifestation of it. He is transcendent and still immanent and in his manifestation he divides himself into subject and object. Adibuddha can be considered under two aspects, supreme compassion and unsubstantiality. Unsubstantiality since he is the denial of every existent thing and supreme compassion since he is moved to reveal himself by the infinite compassion that he feels for our beings which do not really exist. 545 . The next important contribution to the study of the Adibuddha concept was the article in the Encyclopaedia of Buddhism by G.P. Malalasekara, Shinten Sakai and Kanyii Kabese. 546 Malalasekara mostly repeated what was written by de la Vallee Poussin and did not present much new material. About the KaZacakra he wrote that "there is thus nothing new or really important in the doctrines of the Adi-Buddha, for to the Indian mind it is implied in the Trikiiya doctrine of Buddhism, the Sambhogakiiya being virtually a Hindu Deva and the Dharmakiiya, the pantheos or Brahma.,,547 He also stated that "The fundamental feature of this doctrine is that of a primordial Buddha from whom all other Buddhas are ultimately derived.,,548 I will later discuss what is the basis ofthe Adibuddha-theory in the Kalacakra Tantra. Suffice it to say that, considering his categoric statements, it seems that Malalasekara did not study the relevant texts. S. Sakai wrote about the concept in more detail. Referring to the Niimasanglti and the Mahavairocana-sutra, he defined the Adibuddha concept as follows: "the Adi-Buddha is the highest spiritual doctrine, while it is also at the same time the highest material origin. It is the name for the essence-body which is not separate from either material or spiritual, Bhattacharyya. 1923: 113-117. I treat this text in chapter 3. It has been treated by several scholars writing on the Kiilacakra. 544 Bhattacharyya. 1923. 545 Sekoddesatlkii. 1941 :22-23. 546 Malalasek~ra. 1961:213-219 . .'47 Malalasekara. 1961:213. 54. Ibid. 542 '43

91

and is material and spiritual at the same time. It is eternal and imperishable. This is the origin of all things in the universe, because the universe is produced and developed by it. This is the one-great-life-body of the universe and is itself separate from both production and destruction. It is the origin of all things and exists in the inconceivable state. Everything is ruled by it.,,549 I have included this quotation because it gives a definition which is more elaborate and gives quite a good idea about what the Adibuddha doctrine could be, even in the Kiilacakra context, although his reasoning about the material and the spiritual is somewhat difficult to understand. Sakai mentioned the Kiilacakra Tantra and the importance of the doctrine there, but when quoting the inscription by Padma dKar-po already made known by Csoma de Keres, he seems not to have understood the text. 550 Kanyu Kabese concluded the article on Adibuddha, writing about Adi-Buddha in Tibetan and Japanese Buddhism. He brought back the origin of the three and five "dhyiiniBuddhas" in the Mahiivairocana sutra and the Tattva-sa1(lgraha sutra respectively. From these doctrines evolved the concept of Adibuddha or Vajradhara, having its basis mainly in the Guhya-samiija tantra. The transcendental body, speech and mind represents by its nature an assembly of all the Buddhas and this was called the Great Vajradhara or the AlIBuddha. Vajradhara is the essence (iitman) of the the Buddha-families, the Adibuddha, the body of wisdom (jiiiina-kiiya) and without beginning or end. This way of reasoning seems somewhat strange in the Tibetan context. The reasoning of K.Kabese on the Japanese form of the Adibuddha concept is clearer. Adibuddha is the Mahiivairocana Tathagata as the dharmakiiya of the Six Great Ones (the "dhyani-Buddhas"). "All Buddhas, bodhisattvas and other incarnated beings are the reflected bodies, or reflexes, or the incamate bodies of the Adi-Buddha. The AdiBuddha is the "whole" Buddha and a dhyani-Buddha is a "partial" Buddha, and they are respectively called "universal gate" and "one_gate".,,551 Kabese then refers to the difference between Tibetan and Japanese Adibuddha concepts. In the Tibetan tradition the Adibuddha is Samantabhadra and Vajradhara and in the Japanese tradition, the Adibuddha is the dharma-kiiya, Vairocana. The reason fqr that according to Kabese is a difference in the interpretation of the Mahiivairocana sutra. 552 John Newman has a footnote in his dissertation where he compares a passage on Adibuddha in the Vimalaprabhii to a commentary text to the Guhyasamiija Tantra called Vajramiilii (the dating is difficult, but it should be long before the appearance of the Kiilacakra texts) and in that way, the Adibuddha concept could pe linked with the Kiilacakra system long before it appeared openly. Newman suspects that tlris is a quotation from the Vimalaprabhii and in that way interpolated in the Vajramiilii later, otherwise it would be a proof of that the Kiilacakra Tantra is older, something that is not probable. 553 Several other scholars have written on the iconography of Adibuddha. Alice Getty wrote quite extensively about the different manifestations of Adibuddha. 554 Others were A. Malalasekara (Shinten Sakai). 1961 :217. Malalasekara (Shinten Sakai). 1961:218. 55\ Malalasekara (Kanyu Kabese). 1961:218. 552 Malalasekara (Kanyu Kabese). 1961 :219. 553 Newman. 1987a:354-355, note 48. For the coritent of the verse see also later in chapter 4 on VP 104. 554 Getty. 1928. 549 550

92

Gordon, and, later, D.l. Lauf, Chogyam Trungpa, Lokesh Chandra and Wolfgang Schumann, who made an interesting systematic review of the different aspects of Adibuddha. 555 More recently, there have been works published on the iconography of Buddhism where Adibuddha deities have a place. 556 The most recent and also the most important work on the Adibuddha concept is the article by Gllnter Gronbold in 1992. 557 He edited and translated two short works on the Adibuddha in the Tibetan canon. As an introduction to the texts, he wrote, an overview of the Adibuddha concept in the texts and in western research. The earliest text where Gronbold found the word Adibuddha is the Mahiiyiinasatriila1!lkiira by Maitreyaniitha (3 rd or 4th century). He concluded that in this context Adibuddha only signifies a pure chronological aspect. It was the first Buddha among many to come. SS8 In the Tattvasangraha text, Gronbold could not find any allusion to the Adibuddha as said in the article in EB. In the Mafijusrfmalakalpa, the concept as purely temporal (the first Buddha) exists once more. Even in a Hindu text, Gronbold found one place where the Adibuddha can be found, the Gau¢apiida-kiirikii. A temporal meaning of the word is obvious in that text. 559 Next, the Guhyasamiija Tantra was examined. In this text the word Adibuddha was not found, but the corresponding concept is there. The word Bodhicittavajra should be the Vajradhara and there seems to be a monotheistic and emanationist view expressed in the text. Gronbold found that it is not really an Adibuddha concept. 560 Next Gronbold treated the Adibuddha concept in the Mafijusrf-texts. Gronbold interpreted the famous place in MNS 100 as temporal, that is, that Mafijusrf was enlightened from the beginning. The text does not state that he was a creator of the world. In a few other texts, Gronbold found that Adibuddha simply could be interpreted as in Hinduism, that one god is exalted above the others and given very high epitethets. S61 Gronbold then made the first ever intent to clarify the Adibuddha-concept in the Kiilacakra Tantra. He quoted from both the laghutantra and the commentary VimalaprabM. Studying these texts, I found approximately the same quotations and therefore I leave the detailed commentaries of Gronbolds interpretations to chapter four, below. Gronbold arrived at the conclusion that Adibuddha could mean different things in the Kiilacakra context. It can be purely temporal, often it can stand only as the name of the Kiilacakra texts, it can stand in an enumeration of Buddhas and bodhisattvas without any specified meaning and finally, it can stand as a personification of the highest principle which also implies that it can stand for the impersonal concepts of sanya (the Void), Tathatii, Mahiisukha (the great Bliss), etc. I think that the concept can be more specific as Bhattacharya. 1923: 113-117; Gordon. 1952:54,63; D.1. Lauf. 1976:100, 132; Jackson & Jackson. 1984:51; D.l. Lauf. 1979:24-27,34-37.102-103; Trungpa. 1978:37-43,88-89; Chandra, L. 1996:73-80, 188-89; Schumann. 1986:104-114. 556 Rhie & Thurman. 1996:343-348,357-360,430,480,481. 557 Gronbold. 1992:111-161. . 118 Gr6nbold. 1992: 118-119. 559 Gr6nbold. 1992:119-120 . ."0 Gr6nbold. 1992:121-122. 50! Gr6nbold. 1992: 122-124. 555

93

shown later. 562 Gr6nbold also studied some of the Tibetan works on the Kiilacakra, arriving at the conclusion that, concerning the Trikiiya system, Adibuddha has a position above the dharmakiiya concept. In some texts, it is obvious that Adibuddha actually represents the fourth body which is mostly called the sViibhiivikakiiya. I later show that this can also be seen also in the basic texts. Finally, sometimes Adibuddha can stand for the historical Siikyamuni Buddha, something that I have also found in the basic texts. 563 Gr6nbold then commented that the Adibuddha concept can also be found in other texts. Returning to Hodgson's concept of Adibuddha in the Nepalese buddhism, Gr6nbold then made an analysis of his sources, the MNS, the GulJakarmJ4avyuha and the Svayambhu-puriilJa. As mentioned previously when discussing De La Vallee Poussin, the KaralJifavyuha was a late version that mentioned the Adibuddha, that he was Svayambhu and had created the world through meditation. The text is very late (11 th century) and very syncretistic. Consequently, the Adibuddha concept was very influenced by Hinduism. This shows itself from the fact that it also had its origin in the Svayambhu-puriilJa. The name itself is the type of name given to a Hindu text and the text itself is even later than the KaralJifavyuha.564 Finally, Gr6nbold noted that there existed a kind of BuddhistlHindu syncretism in Java around year 1000. In that type of Buddhism, there is a mention of Adibuddha in one of the Vajrayiina-texts. There, the concept was regarded as something "absolute" and having the principle of advaya (non-dualistic). The concept was consequently more widely spread than expected. 565 It is not easy to find Adibuddha depicted in art before the Tibetan thang-kas and sculpture depicting various forms of Adibuddha in later periods. Gr6nbold found some that are coronated and therefore, in many cases, is an Adibuddha figure. A better characteristic of Adibuddha is that his arms are crossed in order to symbolize the union of opposites (prajfiii - upiiya; method and wisdom).566 No depiction of an early Adibuddha existed. Gr6nbold also wrote another article on the concept of Adibuddha, "Weitere Adibuddha-Texte", where he has translated and commented upon three texts treating the Adibuddha concept. 567 The texts were brought from Nepal by B.H. Hodgson in the 19th century. The texts are relatively late and treat the special form of Buddhism which exists in Nepal. The Adibuddha is there seen as an immanent form of the ultimate reality. Griinbold considered these teachings to be influenced by Hinduism and approaching a sort of monotheistic religion developing very late in Nepal. This form of Adibuddha is not the same as the concept which I have found in the Kiilacakra Tantra. The latest contribution which treats the concept of Kiilacakra is Wallace in her recent work on the second chapter of the KCT. 568 Wallace noted that the Adibuddha concept in the Kiilacakra Tantra is primarily related to the corresponding concept in the Mafiju§rfniima-saJigfti. Adibuddha is called the Primordial Buddha because he was the first to obtain Gri:inbold. 1992: 124-128. Gri:inbold. 1992: 128-131. 564 Gr6nbold. 1992:131-133. 565 Gri:inbold. 1992:133-134. 566 Gri:inbold. 1992:135. Hoffmann. 1968:361-378. 567 Gri:inbold. 1995. 56, Wallace. 200 I. 562

56'

94

Buddhahobd by means of the unchanging bliss characterized by perfect awakening in a single moment. ill the Vimalaprabhii the word iidi means "without beginning or end" and without origination and cessation. She stressed in her work that in the Kiilacakra tradition, this refers to the "innate gnosis" (sahajajftana) that pervades the minds of all sentient beings and stands as the basis for both sarrzsiira and nirvii]Ja. When the tantra speaks of the Adibuddha as the one who first attained perfect enlightenment by means of unchanging bliss, it is referring to the actual realization of one's own sahajajftiina. Wallace's conclusion was that Adibuddha refers to the ultimate nature of one's own mind and to the one who has realized the innate nature of one's own mind by means of purificatory practices. 569 This interpretation of the Adibuddha concept is what can be found on for example, the illternational Kalachakra Network's pages on the Internet and is the definition of the practitioner. 570 I am not wholly convinced that this psychological interpretation is the only way of interpreting the concept. The texts themselves undoubtedely also contain the cosmological side of the Adibuddha concept. I will return to this discussion later. Finally G. Toffm has done interesting work on the Newar Buddhists of the Kathmandu valley. For example, the city of Patan has a Vajrayiina Buddhist geography. The centre of the city was planned to host a stilpa for Vairocana, who is the central "Adibuddha" figure of the five jinas in the Newar Buddhism. The five jinas are also worshipped with Vajrasattva as the Adibuddha, as is also the stilpa of Svayambhilniith, which is at the origin of the Adibuddha idea. 57 1

4.2. THE ADIBUDDHA CONCEPT IN THE KALACAKRA TANTRA.

4. 2. a. Introduction to the texts. ill this chapter, the following three texts will be treated: Paramiidibuddha (P), Paramiidibuddhoddhrta Srz Kiilacakra-tantra-raja (the laghutantra) (KCT), Vimalaprabhii (VP). For a description of these texts see chapter 3.1. For this chapter I have also consulted the published translations especially the unpublished thesis by John Newman, The Outer Wheel of Time: Vajrayiina Buddhist Cosmology in the Kiilacakra Tantra from 1987. He has translated the verses 1-27 and 128-170 of the first chapter of the KCT and the Vimalaprabhii. The translations in the chapter are by me with assistance from the late lecturer in Sanskrit Klas Hagren of the Department of illdology at Uppsala University. The Sanskrit of these two texts has been edited by B. Banerj ee 572 and 1 Upadhyaya, S.Rinpoche, V.Dwivedi and S.S.Bahulkar573 in illdia and the Ti-

Wallace. 2001 :17-18. The International Kalachakra Network, www.kalachakranet.org 571 Toffin 2000:48-49, 68. 572 BaneIjee. 1985. 573 Virnalaprabhatika Vo1.I. 1986; Vimalaprabhatika Vol.II. 1994; Vimalaprabhatika Vol.lI!' 1994, '69

570

95

betan translation is found in the Tibetan Canon and in' the complete works of Bu-ston. 574 The complete chapter 1 of the KCT has also been translated to German by B. Banerjee. 575 I have also used the translations of Wallace 1995 and Hartzell 1997. 4.2.h. Adihuddha.

The word Adibuddha itself is found in very few places in the text Sri Kalacakra-tantra-raja (KCT). The meaning of the concept Adibuddha can be found in many more places in the text. The deity Kalacakra is actually, in some places, to be equalled with Adibuddha. Quotations will be given later in the text. The fIrst mention of Adibuddha is to be found in the very title of the tantra, Paramadibuddhoddhrta-Sri-Kalacakratantra-raja, which means that the text is drawn out of the original text which is called Paramadibuddha. This text is supposed to be the original lost mulatantra (root-tantra) and the title can be translated as "the supreme primordial Buddha." but as the word adi also can mean "the first" it can also mean "the supreme first (original) Buddha". This double sense of adi is a regular theme in the Kalacakra texts. Most of the time the word Adibuddha signifies the name of the text. At many other occasions it has a temporal meaning "the Buddha who first reached enlightenment". In the Kalacakra system, the Adibuddha-concept is central, although it is rarely mentioned under this name. Adibuddha is expressed in the whole text as it is said in the Vimalaprabha. The tantra text is expressive of the Kalacakra (god), and, as Kalacakra = Adibuddha, the nature of Adibuddha (god) is to be expressed (vacya) and Adibuddha expresses the tantra text. 576 Consequently, essentially it would be necessary to resume the whole tantra text, but here a more practical approach was taken and I limited my research to the concept Adibuddha as it is expressed in the text. To begin, a repertory was made of all the places where I found the word Adibuddha in the Sri Kalacakra (KCT) and in the first chapter of the Great Commentary Vimalaprabha (VP) and then I analysed the concepts. There is an introduction in the first chapter of the VP which is very interesting as it summarizes the ideology of the tantra. The concept of Adibuddha has many different connotations in the texts, or rather, it is possible to deduce that there can be a kind of common concept behind the different terms which can be called "Adibuddha" The different terms are as follows, according to Louis de La Vallee Poussin: Kalacakra, Vajrasattva, Vajradhara, Vajrakaya, Jinavarajanaka (the progenitor of the best of jinas), Jinajanaka (progenitor ofjinas), Jinendra (jina-indra),jinapati (master ofjinas), tribhuvanajanaka (progenitor of the three worlds), Sri vajri, Sri janetr, tribhuvanajananin, Vajravega (the fIerce aspect), anahata (indestructible), vajrayoga and visvarupa. 577 These terms are interpretations by de La Vallee Poussin and it could be questioned if they really express the Adibuddha concept. The concept looses a great deal of its meaning KCT in Toh.362 and 1346. VP in Toh.845 and 1347. Bu-ston, 1965abcde. Banerjee. 1959. An annotated translation without the VP commentary. 576 Vimalaprabba I in VP Vol.1. 1986:18; Newman. I 987a:274. 577 de La Vallee Poussin. 1908:95. 574

575

96

when it is so widely defined. In any case, it is clear from the context that there was something called Adibuddha that existed at the time when the Kalacakra texts were written. The problem remains if t!.Iere really exists a concept with this content and if there does exist a coherent concept of Adibuddha in the texts or if there are many different concepts related to each other but not necessarily united? The word Paramadibuddha is used in different ways in the Srf-Kalacakra-tantra-raja and the Vimalaprabhii. It can signify the Kiilacakra mal}r:jala, the Buddha Siikyamuni as Adibuddha when he teaches the Kiilacakra, the deity Kiilacakra himself, and for the text Paramiidibuddha, the miilatantra itself.578 Paramiidibuddha is another word for the miilatantra and Adibuddha can be a designation for the laghutantra or the miilatantra. When mentioned in other contexts, the Kalacakra Tantra is often called the Adibuddha Tantra.

4.2.1 Adibuddha in the Sri-Kalacakra-tantra-raja (KeT) and the Vimalaprabhii (VP). In this chapter, I treat the Adibuddha-concept in the two texts KCT and VP. In spite of KCT being the basic text for the VP commentary, I will discuss them together. They were transferred together and the commentary is of great importance. I will treat them in the order of chapters, beginning with the first introductory chapters of the Vimalaprabha commentary and then continuing with the verses of the KCT with the commentary.

4.2.1.0. Adibuddha in the the Sri Kiilacakra-tantra-riija (KCI) and the Vimalaprabhii (vp) commelltary to chapter I - LokadhiitupatalalJ - the chapter 011 the outer world. The Vimalaprabhii commentary is, like the Srz Kalacakra-tantra-riija (KCT), divided into five chapters (patala) and a number of subchapters called "great brief accounts" (mahoddesa). VP. Ll is: Vimalaprabha, chapter I (Lokadhiitupatala) and subchapter 1 (mahoddeia).579 A considerable portion of the quotations are from the first chapter, it being a sort of introduction to the whole commentary containing many general ideas valid for the whole of the text. The first three mahoddesas 580 are introductory and there exists, for example, a table of contents for the whole VP textin the second subchapter (mahoddeia).58 I As a start some places in the Vimalaprabhii where the word Adibuddha or Paramiidibuddha clearly stands for the miilatantra (the root-tantra) and nothing else will be mentioned. 582

A good example of all these meanings can be found in the VP 1.2 in VP vaLL 1986:12; Newman. I 987a:245-246. 579 For details see the chapter "Survey of the contents of the ideas". 580 Vimalaprabhii VaLL 1986:1-30 and Newman. 1987a:221-316. 58[ Vimalaprabha VaLL 1986:12-14 and Newman. 1987a:248-260. 5B2 Some technical information: The reference to the Ktilacakra texts are as follows. The Srf-Ktilacakra-tantra-rtija (the laghutantra) has been edited in Sanskrit three times. First, the edition by Lokesh Chandra in 1966, then the edition by B.BaneIjee in 1985 and lastly in the edition of the Virnala578

97

Vimalaprabha Chapter (patalaM 1. 2 (second mahoddesa) in VP voLl 1986: 19, line 16; VP 1.2 in VP voU 1986:19, line 19; VP 1.2 in VP voU 1986:19, line 27; VP 1.2 in VP voLl 1986:21, line 24 and 27; VP 1.3 in VP voLl 1986:24, line 8 and 13; VP 1.3 in VP voU 1986:29, line 2,14,16 and 17; VP 1.4 in VP voLl 1986:30, line 17,16 and 23; VP 1.4 in VP voLl 1986:32, line 15 and 24; VP 1.4 in VP voLl 1986:33, line 8 and 16; VP 1.4 in VP vol.! 1986:34, line 1; VP 1.4 in VP voLl 1986:37, line 8; VP 1.4 in VP voLl 1986:38, line 7; VP 1.6 in VP voLl 1986:47, line 1; VP 1.6 in VP voU 1986:51, line 29 (in the mulatantra paramiidibuddha); VP 1.6 in VP voLl 1986:52, line 5, 7; VP 1.7 in VP voLl 1986:52, line 12; VP 1.7 in VP voU 1986:53, line 24; VP 1.7 in VP voLl 1986:65, line 21; VP 1.8 in VP voLl 1986:89, line 25; VP ILl in VP voLl 1986:157, line 12; VP IT.7 in VP voLl 1986:256, line 1 (paramiidibuddha is the malatantra!); VP III.5 in VP vol.IT 1994:107, line 10; VP III.5 in VP vol.II 1994:108, line 4; VP ID.6 in VP vol.IT 1994:148, line 4; VP N.l in VP vol.IT 1994:150, line 14; In the following, I present quotations from the KCT and the VP where the word Adibuddha is a little more elaborated on and more information on the concept can be found. I begin with quoting the first lines of the first subchapter (mahodde.sa) of the first chapter Lokadhiitupata1a of the Vimalaprabhii. It is the first of the three introductory subchapters of the VP. These verses are a type of homage to Kiilacakra, Adibuddha and others.

This first subchapter is comprised of 102 verses giving homage to the content of the VP: namalJ srfktilacakraya sunyatakaruT}iitmane I tribhavotpattik$ayabhavajiianajiieyaikamurttaye II 583

Homage to Kiilacakra, who has as his content emptiness and compassion, without origination or annihilation of the three existences, who is regarding a consistent embodiment of knowledge and objects of knowledge as non-existent. 584 This is probably a deflnitionlhomage to Kiilacakra as the protective deity, the yidam. He is endless, without beginning, and sunyatii and karul}ii, which are all also referring to the Adibuddha concept. Another interpretation, which seems less probable from the context, is that the word Kiilacakra here is referring to the text (KCT). The commentator then should be honoring the text. Referring to the first interpretation, the problem of the interpretation of the Adibuddha concept has already be!,)n stated. Kiilacakra is said to be eternal and consists of both emptiness and compassion. The same concept is later applied to the Adibuddha. Is then the concept of Kiilacakra equal to the concept of Adibuddha? This question will be addressed later. Another of the introductory verses of the first chapter of the VP is given below: prabhii texts. The Vimalaprabhii texts have been edited in three Volumes. VP Volume I. 1986 contains chapter 1 and 2; VP vo!.lI (1994) contains chapter 3 and 4 and finally, VP Volume III contains chapter 5. I normally refer to the latest printed VP editions of both texts. 583 Vimalaprabha 1.1. in VP vo!.L 1986:1, line 1. 584 The following quotations from Vimalaprabha, chapter I, subchapter 1 (VP I.I) have been translated by Newman. 1987a:221-227.

98

siikiirti ca (Pi) 585 nirtikrtir bhagavati prajnti taytilingita utptidavyayavarjito 'k~arasukho htisytidi saukhyojjhita/:t / . buddhtintiTfl janakas triktiyasahitas traiktilyasaTflvedaka/:t sarvajilaJ:z paramtidibuddhabhagavtin vande tam evtidvayam //586 To the one embraced by the Bhagavati Prajnti,S87 the one who is aspectless although possessing aspect; to the one who has the bliss of the unchanging and who has abandoned the pleasures oflaughter and so forth; to the progenitor of the Buddhas, without origination and annihilation, possessing the three bodies, rightly knowing the three times - the omniscient Bhagavtin Paramtidibuddha, I worship that very non-duality. // Here various aspects of paramadibuddha are being presented; non-duality, unchanging bliss, progenitor of the Buddhas, possessing the three bodies, knowing the three times, without origination and annihilation, with aspects though without aspects and omniscient. Here, for the first time, the main aspects of the Adibuddha are clearly presented. At the beginning of the verse his consort, Visvamata, is mentioned. When Kalacakra is embraced by his consort in the iconography, it is a representation of the two opposites prajna and upaya, male and female, etc. Is it here stated that Paramadibuddha is Ktilacakra? At the end of the verse it is said that Paramtidibuddha is the non-duality (advaya). How can that be consistent with the two statements in the same verse? I think that it is not a great problem as sometimes Ktilacakra is identified with AdibuddhaIParamadibuddha and sometimes he is presented as one of the two polarity principles. The ambiguity of the concepts therefore is quite clear. The problem becomes even more complicated when one considers the concept of the fourth body Sahajakiiya, and the concept of paramalqara, the supreme unchanging. I will return to this problem later. The next concept is that of being aspectless although possessing aspect. This is the kind of contradictory statements very common in the mahayana philosophy. It is possibly a way of saying that there is something beyond the aspects. The concept of "progenitor of the Buddhas" is also somewhat enigmatic. By the Buddhas in these texts and referring to the Ktilacakra mar:u!ala are probably meant the five jinas. They consequently have their origin in the Paramadibuddha. In the centre of the Kalacakra mar.lI!ala, the deity Kalacakra is normally depicted as being embraced by his female consort. They represent the union of opposites and the fmal goal of mahasukha or sunyata. Sometimes Alqobhya and Vairocana are situated in the centre of the ma1Jrjala. The other four jinas, Amitabha, etc., have their place in the four directions. Consequently, when it is stated that Paramadibuddha is the progenitor of the Buddhas, it is probably meant that he is at the origin of the five jinas, corresponding to the concept of Adibuddha as being a transcendental original principle. It is not said that Paramadibuddha creates the Buddhas, and in consequence the world, but they have originated from the Adibuddha.

Api from the Tibetan kyang. Vimalaprabhii. 1.1. in VP voU 1986:1, line 3. m From the context it seems that here is meant the female consort of Kiilacakra called Viivamiita (the allmother). The two are mostly depicted in the yab-yum (father-mother) position in the iconography. 585

5.6

99

Paramiidibuddha is not created and also without a final ending. The same characteristics, although not with the same words were given to Kiilacakra in the preceeding verse. Adibuddha consequently, has as one of "his" main characteristics being eternal, beyond the changing world. This is, of course, not a new idea in Buddhism. It was Siikyamuni Buddhas main philosophical question from the beginning. Suffering (du/:lkha) is that which changes. NirviilJa is to go beyond that which changes. Is there then something new with the Adibuddha concept in this respect, or is it just another designation of nirviilJa, or as it is designated in later Buddhism, emptiness (Siinyatii) or the great bliss (mahiisukha)? There seems to be some difference in the meaning as in early Buddhism it seems as though nirviilJa does not have much to do with the beginning of the world, however Adibuddha has the quality of being at the origin of the world. Consequently one cannot say that Adibuddha can be equalled to nirviilJa. The principle of Adibuddha stands for a different sort of timelessness. Paramiidibuddha is also said to possess the three bodies which probably means the three trikiiya system of Dharmakiiya, Sambhogakiiya and NirmiilJakiiya. This is not really in line with the teaching of four bodies of the Buddha which is taught in general in the Kiilacakra texts. The solution to this is evidently to consider that Paramiidibuddha himself is considered the fourth body, or, as is expressed in other mahiiyana theories of the four bodies, the fourth body is a sort of essence of the other three and therefore not always mentioned. 588 Knowing the three times, past, present and future, is another of the concepts associated with the Paramiidibuddha. It is a state of being beyond time which in extrapolation could imply a theory of predestination. Paramiidibuddha knows the future and consequently the future must in some way exist. It implies the concept of omniscience also mentioned here. To predict the future is nothing new in Buddhist philosophy. Buddha Siikyamuni made many prophecies. The very basic Kiilacakra text (KCT) is a sort of prophecy because one can fmd in it many historical events and personalities like Christ and Muhammed whose existences were predicted by Buddha long before their historical existence. Consequently, knowledge of the three times was not a privilege of Paramiidibuddha alone. Omniscience (sarvajftii) is a quality given to Adibuddha in several places in the texts. It could mean something in the way of thinking just described. By knowing everything at all times, one is all-knowing. The non-duality concept (advaya) is something mentioned repeatedly as a qualification of iidibuddha or paramiidibuddha. In mahiiyiina philosophy, it is beyond prajftii and upiiya (wisdom/method; male/female). This is a key concept of Adibuddha because he must, by defmition, be beyond the dualities in the world. The next quotation is also from the first page of the VP.: buddharr sirrhiisanastharr tribhuvanamahitarr vajrayogarr visuddham tattvarr kiiyaprabhedair abhavabhavagatarr ~orjasiikiiram ekam I jniinajneyaikabhiltarrjinavarasamayarr dViidasiikiiram aflgai/:l sattviirtharr bodhicittarrjinakulisapadarr kiilacakrarr pralJamya II 589

The Buddha sitting on the lion throne, the pure vajrayoga worshipped in 588

589

Makransky. 1990: 138-142. Vimalaprabha 1.1 in VP vou. 1986: 1, line 7 ;Vimalaprabha I.1 in VP Vol.l. 1986: 1, line II.

100

the three existences, a single reality having sixteen aspects due to the division in bodies (ktiyaprabheda),590 who has gone beyond existence and-origination, the unity of knowledge and objects of knowledge, an assembling of what is the best ofthejinas, the true aim having twelve aspects due to the parts, bodhicitta, the thunderbolt abode of the jina. I worship this Kiilacakra. Here allusi~n is probably made to Buddha Siikyamuni as teaching the Kiilacakra. When teaching, Buddha is transformed into Kiilacakra and sits on the lion throne. The subject of the connection between the teachings of the four bodies (kiiyas) of the Buddha and the Adibuddha is also touched on as sixteen aspects of the bodies, which makes four aspects on each body. Next, still on the fIrst page of the VP, is the very introductory verse of homage to the Adibuddha which for the fIrst time in the text gives the important characteristics of the word: sarvajiio jiiiinaktiyo jinapatisahajo dharmakayas tathii sambhogo nirmiilJaktiyo 'pi dinakaravapu1;l padmapatriiyatiilqal; / yoga1;l suddho vimok~air gatabhavavibhavai1;l ktiyaviikcittariigaiIJ prajiiopiiyiidvayo yo nrsuradanunutas tal[l pralJamyiidibuddham 1/ 591

Just like [he is] omniscient, thejiiiinaktiya, the master ofjinas, the sahaja [ktiya], and the dharmaktiya, [he is] the sambhoga [ktiya] and the nirmiilJaktiya. [He is] an embodiment of the day-maker 592 [and has his] eyes spread out like lotus petals, [he is] in the pure union gone beyond origination and dissolution through the liberations of the body, speech, mind and passion, [he is] non-dual wisdom and method [and] praised by gods, men, and demons. I worship this Adibuddha II This is the most explicit reference to Adibuddha in the Vimalaprabhii, The author relates all the aspects as a homage at the beginning of the text. He gives several aspects of the Adibuddha as follows: - Omniscient (sarvajfiii) - someone who knows everything in the world. See above (p. I 04). - The knowledge body (jfiiinakaya) - this qualification is given at several places in the text to Adibuddha and can sometimes be regarded as another designation of the fourth of the four bodies of the Buddha, normally designated in the Kiilacakra texts as Sahajakiiya. It is also sometimes given as a personifIcation of the wisdom of Buddha as it is described in the fIfth chapter of the Kiilacakra-tantra-riija, the Jfiiina-patalaJ:! (the The sixteen aspects of reality are explained in-Yimalaprabha YoLI. 1986:45 and translated in Newman. 1987a:376-377. The aspect are the four joys (linanda)connected in different ways withji'ilina (wisdom), cilia (mind), speech and body. All these aspects also have a connection with the theory of the four kliyas (bodies), who here are called Sahajakliya, Dharmakliya, Sambhogakliya and NirmlilJakiiya. The sixteen realities are also explained in the Yimalaprabha YoLI. 1986:8 and translated in Newman. 1987a:236. 591 Yimalaprabhii 1.1 in VP voL I. 1986: I, line 11. 592 The sun. 590

101

chapter on knowledge). Jiliina in that chapter seemS to be the knowledge needed in order the reach the state of the wisdom of the supreme unchanging bliss (paramiik~arasukhajiliina).

- The master ofjinas, that is, the sahajakaya - the concept of sahaja is very complex in Buddhist tantric philosophy.593 Kvaeme translates it as "simultaneously-born", the literal meaning of the word. In this context, it can suffice to say "innate". The master of jinas related to the concept of sahajakaya probably signifies that Adibuddha is at the origin of the five jinas (see above, p.102) and not himself produced by anyone else. Jinapati is a common word in the Kiilacakra texts and at several places it is identified with the Adibuddha concept. 594 It can even be said to be one of the main words for denoting the concept of Adibuddha in the Kiilacakra texts as the word "Adibuddha" is extremely rare. - Then are mentioned the other three bodies of the Buddha: dharma-, sambhoga-, and nirmiiIJakiiya which, in this context, only means that as the world is manifesting itself in more non-subtler ways, it is still the Adibuddha who is behind this development. This problem will be treated in the chapter on the four bodies. - The day-maker (sun) (dinakaravapu)- this designation is perhaps only there in order to connect Adibuddha with the most powerful force in nature, the sun. It also represents the sambhogakaya. - Eyes spread out like lotus petals (padmapatriiyatiik~a) - It could be an honorific designation of Adibuddha as a Buddha who has as one of his characteristic signs that his eyes are wide and spread out. It also represents the nirmiiIJakiiya. - Paramiidibuddha is also pure union (yoga~ suddho) gone beyond origination and dissolution and the limitations of the personality. Here is a designation which says that the Adibuddha is in principle eternal and not created. - The foregoing interpretation fits in quite well with the last statements in the verse that Adibuddha is "non-dual wisdom and method" (prajilopiiyiidvayo) where it is explicitly said that Adibuddha is the non-dual (advaya) resulting from the union of prajilii and upiiya.

This verse gives the basis of most of the qualities of the Adibuddha concept. That is the reason why I have elaborated on the defmitions of the concepts. I will refer back to this verse when finding the same type of definition in other places. I will continue with other verses from the same introduction to the Vimalaprabhii. This one from the second page of the introductory verses: prajnopayatmako yogaJ:z saTflsthanakayarddhigaJ:z I vajrasattvo mahasattvo bodhisattvas tathagatai!; II ukta!; samayasattvo yo bhavabhavak.ayo vibhu!; I anadinidhanaJ:z santo bodhicittaTfl praIJamya tam 11 595

The yoga consisting of wisdom and method, the miraculously 593

594 595

See K vaeme. 1975 for a thorough treatment of the concept of sahaja in Buddhist Sanskrit literature. See for example in KCT V:243. Vimalaprabhii 1.1 in VP vo1.1. 1986:2, line 1.

102

accomplished body; by the tathagatas called vajrasattva, mahasattva and bodhisattva. Also called samayasattva, the lord who has destroyed the existent and non-existent. I worship that beiinningless, endless, peaceful bodhicitta II Here homage is made to bodhicitta, which in VP I.1 p.l,line7 is equalled to Ka.lacakra. Bodhicitta is very important in the Ka.lacakra texts. The word normally denotes the condition of the mind when it strives to reach bodhi (awakening, illumination?), probably the meaning in this context. A very wide meaning is given to the word bodhicitta. This is another of the introductory verses in the VP:

jananfl!l sarvabuddhanaY(! utpiidak~ayavarjitam / caryaY(! samantabhadrasya visvamiitaY(! pralfamya tam //596 The progenitor of all the Buddhas, the one who has abandoned origination and destruction, the one who is connected to the conduct of Samantabhadra. I worship this Visvamiita II Here the homage is to Visvamata who is the female counterpart of Ka.lacakra, always depicted in the yab-yum position, as to signify the union of prajiia. (wisdom) and upa.ya (method) and the resulting Maha.sukha (great bliss). Interestingly enough she is also called "progenitor of all the Buddhas", more' or less the same wording used to describe the A.dibuddha (jinajanaka). She is related to Samantabhadra, who in other tantric traditions is regarded as the A.dibuddha, for ex., the Tibetan rNying-ma-pas. She is also beyond origination and destruction like the A.dibuddha. A conclusion from the descriptions of both Kalacakra and Visvama.ta is that the characteristics of A.dibuddha can be found for all three concepts. The level of the state of mind before and after the union between prajiia. and upa.ya is described in the same way. Here follows another of the introductory verses of the VP:

alikiilisamapatti huY(! phar kiiradi vmjitiim / akearodbhavakiiyan ca kiilacakraY(! pralfamya tam //597 Even though he has abandoned the absorption of ali and kiili, and the letters huY(! , phar, and so forth, he is the body arisen from the unchanging. I worship this Kalacakra. II

Kalacakra is here presented as the body arisen from the unchanging. Consequently, as A.dibuddha, as shown later, sometimes is regarded as the unchanging, Ka.lacakra could eventually be said to have arisen from A.dibuddha. This could be a very decisive statement of the relationship between A.dibuddha and Kalacakra. On the other hand the "unchanging"

596 597

Vimalaprabhii I.1 in VP yol.l. 1986:2, line 19 .. Vimalaprabha I.1 in VP yoU. 1986:2, line 21.

103

(ak~ara) also has other meanings and there is a difference to the concept of "the supreme unchanging" (paramiik~ara). 598 Another of the introductory verses of the VP:

sarvajna11l jnanakiiyiikhya11l miirtta/:uf.avapu~a11l vibhum I . ta11l tattva11l ~ot/.asabhedatal;t II catul;tkiiyiitmaka11l buddha11l vajrasi11lhiisane sthitam I stuta11l suriisurair natvii sucandriidhye#ta11l purii II 5"

padmapatriiyatiik~a11l

Praised by the gods and demons is: the omniscient one, the one called wisdom body, the one who appears like the sun, the lord, the one with the eyes spread out like a lotus petal,600 the Buddha consisting of the four bodies due to the essential reality which is divided into sixteen parts, the one who sits on the vajra lion throne, who was previously called upon by Sucandra. Here reference probably is made to Buddha Siikyamuni because he is sitting on a lion throne and listened to by Sucandra. He has some of the same characteristics as Adibuddha. In this case, it is not strange because when teaching the Kiilacakra Tantra to Sucandra, he was transformed into Kiilacakra and received his characteristics, just as the current Dalai Lama is transformed into Kiilacakra ritually as he gives the initiation. In this verse, the teaching of the four bodies of the Buddha is already established. The concept of tattva is important here and the four bodies is a way of dividing this "essential reality" into separate parts. Tattva is a concept essentially used in the Sii17lkhya philosophy. In that system, there are 25 different kinds of tattvas and there are certain similarities with the usage in the Kiilacakra Tantra. 601 Another of the introductory verses of the VP:

suddhajniinaikayogo jinavarasamayas cittadharmaikayogal;t viiksambhogaikayogas tribhuvanam ahita/:l kiiyanirmiilJayoga/:l I jniinajneyiidvayo 'sau gatabhavavibhavo vajrasattvas caturdhii prajnopiiyiitmaka11l ta11l nrsuradanusuta11l vajrayoga11l pralJamya II 602 The union of the pure and knowledge; the best vow ofthejina, the union of mind and dharma [body]; the union of speech and the enjoyment [body]; the union of body and the emanation [body] worshipped by the three existences; this non-dual knowledge and object of knowledge, past existence and non-existence, is four-fold Vajrasattva. Homage to that vajrayoga consisting of wisdom and method that is praised by gods, men, and demons. II

I will treatthis problem later when commenting on the verse KCT V:127. Vimalaprabhii I.l in VP vol.1. 1986:2, line 23. 600 The same tenn was used for Adibuddha in VP voU: I, line II. See my commentaries on p.114. 601 Larson. 1979:176-201. 602 Vimalaprabhii 1.1 in VP vol.I. 1986:3, line 1. 5••

5••

104

Vajrasattwl and vajrayoga are the main subjects in this verse and it is interesting to see their relation to Adibuddha. Vajrayoga is a difficult concept in the Kiilacakra. In some way in this verse there is a connection between vajrayoga and the four bodies of the Buddha. 603 There are variations of yoga (perhaps here more i!1 the meaning "union") connected with the suddhakiiya, the dharmakiiya, the sambhogakiiya and the nirmiilJakiiya. Each has its ekayoga or "union into one" with something else, the knowledge (jfiiina), the mind (dtta), the speech (viik) and the body (kaya). Consequently, perhaps there is a connection with Vajrasattva who is related with the four bodies. Vajrasattva is at times, in the Kiilacakra texts, associated with Kiilacakra and Adibuddha. It can actually be another word denoting Adibuddha. Another of the introductory verses of the VP: yad vyiikrtalJl. dasabalena puriilpatantralJl. guhyiidhipasya gaditiit paramiidibuddhiit I tat kiilacakralaghutantram idalJl. kaliipe mafijusrfyii nigaditalJl. sakalalJl. munfniim II 604

By means of his ten powers, the Buddha previously made a prophecy [containing] the short tantra out from the Paramiidibuddha spoken to the master of the secret [Sucandra]. Thus, Mafijusrf [= the king Yasas] expressed this entire Kiilacakralaghutantra to the sages in Kaliipa. II Here it is said that Buddha Sakyamuni prophesied that King Yasas of Sambhala was going to write the laghutantra. Actually, it is said in the text that it was Buddha himself who authorized the short tantra (alpatantra or laghutantra?) based on the root-tantra Paramiidibuddha. Mafijusrf (Yasas) redacted it for the sages in the capital of Shambhala, Kaliipa. It should then have been taught in Shambhala for many years and then finally brought out from Shambhala by PilJt/o into India. It is here very obvious here that Paramiidibuddha is just the name of the basic root-tantra. The master of secrets who should have preached the Paramiidibuddha tantra was VajrapiilJi Sucandra. The following is the last among the 102 introductory verses of the first subchapter of the VP that I will quote: fikii sucandralikhitii sarvayiiniirthasacikii I sii mayii II likhyate laghutalltrasya malatantriinusiirilJi I granthadviidasasiihasri savajrapadabhedilli 11 605 ~a~risiihasrikii yii' 'sit pU1:uj.arfkelJa

The sixty thousand line commentary written by Sucandra revealed the meaning of all the vehicles. By me, Puwj.arika, a twelve thousand line text on the abridged tantra, following the basic tantra, with a division of the vajra word. II Here it is stated that there existed an original commentary on the root-tantra Paramiidibuddha. This "Mula-Vimalaprabhii" contained 60,000 verses and was written by Sucandra. The Vimalaprabhii now extant in 12,000 verses is a shorter version of that one 60J 604 605

See Newman. 2000. Vimalaprabha 1.1 in VP vol.I. 1986:3, line 15. Vimalaprabha l.l in VP vol.l. 1986:3, line 17.

105

and a commentary on the abridged laghutantra. It is also stated that the Vimalaprabhii follows both the laghutantra and the lost mUlatantra. The fore-going is stated clearly in the great commentary Vimalaprabhii when the' text gives a sort of table of contents of the whole tantra in the second subchapter of the first chapter of the VP: .

anu prajiiopiiyiitmako vajrayoga iidibuddho niranvayal;! kiilacakro bhagaviin abhidheyal;!1 sa ciinayii paiicapatalasvabhiivayii 'vasthital;!I"6 Here, the vajrayoga (vajra-union) that consists of wisdom and methodthe Adibuddha who is without causal connection (niranvayal;!), Bhagaviin Kiilacakrais the subject. Also, it [the vajrayoga] consists of these essential subjects of the five chapters. 607 Consequently, this means that in essence the whole tantra treats the concept of Adibuddha. Here is the fust place in the Kiilacakra texts where Adibuddha is qualified with the word niranvaya "without causal connection". This evokes the discussion of the qualification that I made in chapter 3 when this word was used to qualify Adibuddha in the Maiijusri-niimasangiti. 608 Here, the wording is a very undramatic qualification of Adibuddha as "without causal connection", which only seems to mean that the Adibuddha is beyond duality and is the very non-duality. As in other places, .there is the problem that Kiilacakra is also placed on the same level as Adibuddha. Likewise, the term vajrayoga can be described as being on the level of Adibuddha, that is, the union of wisdom and method. Still another quotation from the second introductory chapter of the VP:

mahiisukhiiviise paramiidibuddhavajradhiitumahiimaTJ4ale vajra si7flhiisanasthena buddhabodizisattvakrodhariija devaniigadevatiidevatfga7;la parivrtena traidhiitukavanditacara7;liiravindena traidhiitllkaikacakravarttinii paramiidibuddhena niranvayena 60. srrkiilacakrabhagavatii sucandriidhye#tena dViidasasiihasra7fl paramiidibllddha7fl niranvaya7fl kiilacakra7fl tantrariija7fl vajradharajiiiinakiiyasiilqibhiitayii niimasangftyiilingit07fl sarvatantre~u vajrapadasiilqibhiitam. 610 [The subject here is about Buddha Siikyamllni teaching the Kiilacakra to Sucandra] He [Buddha Siikyamuni] sat in the abode of great bliss - in the great ma7;ltjala of the sphere of vajra of Paramiidibuddha -on the vajra lion throne. He was encircled by a host of Buddhas, bodhisattvas, wrathful kings (krodhariija), gods, niigas, and male and female deities. The three realms Vimalaprabhii 1.2 in VP vo!.1. 1986:12, line 24. Newman. 1987a:248. 6.. See the discussion above on MNS:I00 on p.76 and notes 477-78. See also below on p.160-61, note 819 which is the beginning of the commentary to KCT V:89. Also Davidson. 1981 :30. 6.. From the context, I chose to read niranvayena instead of the variation nirandhayena. See VP vo!.!. 1986:12, notes 3 and 4. 610 Vimalaprabhii I.2 in VP vo1.I. 1986:12, line 4-8. 606

601

106

saluted his lotus-feet. He is the sole cakravartin of the three realms, the Paramadibuddha without connection (niranvaya). He is the Bhagavan Sri Kiilacakra. Sucandra requested him for instruction and he taught the 12000 verse Paramiidibuddha without parts (niranvaya) and the Kiilacakra tantrariija. It is embraced by the Niimasaizgiti that clarifies the knowledge body (jiianakiiya) of Vajradhara. The vajra words are made clear in all tantras [by the Paramiidibuddha )611 As when first mentioned above, the Paramiidibuddha is equalled to the Kiilacakra mmJq.ala. Buddha Siikyamuni is seated in the malJq.ala when giving the teachings of Kiilacakra to king Sucandra. Later in the text, it is mentioned that Buddha is also the Paramiidibuddha without connection (niranvaya), the same qualification of Adibuddha that is discussed below (p.155-156). This is the only place where Buddha Siikyamuni is actually said to be Paramiidibuddha. This seems to be a way of stressing the importance of the Buddha when he is teaching the Kiilacakra and is transformed into Kiilacakra. Here, Buddha is also equalled to Bhagaviin Kiilacakra. He is also the cakravartin, that is, the ruler of the world. The Buddha is possibly given all these characteristics in order to maintain an even stronger position when teaching the Kiilacakra Tantra. In the later part of this text, Paramiidibuddha signifies the text Paramiidibuddha, as it is said that the 12,000 verse text was taught. In the next sentence, it is said that Buddha taught the Paramiidibuddha and the Kiilacakra-tantra-riija. This possibly only means that the shorter text was already inherent in the longer original text. The texts of Paramiidibuddha and Kiilacakra are embraced by the Niimasangfti. This could mean that the main ideas in the Kiilacakra were already expressed in the Niimasangfti. It is also said that the Jfiiinakaya (knowledge body) of Vajradhara is clearly exposed in the Niimasangfti. This probably means that allusion is made to the place in Niimasaizgiti where Adibuddha is mentioned (MNS Chapt. X, 24 or verse 100). The author is generally very conscious about the importance of the Niimasaizgiti and he cites it many times. As quoted below, in verse KCT V: 248, Adibuddha is also equalled to Vajrayoga. Here follows another quotation from the introductory part of the VP: vacyo bhagaviin kiilacakral; paiicapatalasvabhiivatayii 'vasthital; vifcaka1!'l kiilacakram abhidhiina1!'l paiicapatalatmakam / atha iidibuddho bhagaviin vacyal; / vacakam adibuddham abhidhiinam iii vacyavacakalakeWIah /612

That which is to be spoken is established as Bhagaviin Kiilacakra, the essential topic of the five chapters. The speaker [is established as) the Kiilacakra speech that consists of five chapters. Also, the characteristics of that which is to be spoken and the speaker: "the Bhagaviin Adibuddha is that which is to be spoken; the speaker is the Adibuddha speech" - these are the characteristics of that which is to be spoken and the speaker. 613

611

61' 613

Newman. 1987a:245-46. Vimalaprabhii 1.2 in VP yo1.I. 1986:15, Iine3. Newman. 1987a:260-61.

107

Here the relationship between the two concepts deity/text is alluded to. The one who speaks is Bhagaviin Kiilacakra and, later in the text, Adibuddha and the text is also called Kiilacakra and correspondingly Adibuddha. The names are the same for person and text. It is not easy to understand this relation between the spoken and the speech. It is more of a grammatical analysis. From here up to the end of the 2 nd udde§a (subchapter), the text is a commentary to the sort of preface appearing at the beginning of the 2 nd uddesa of the Vimalaprabhii in the foregoing quotation (VP vol.I: 15, line 3). It gives very interesting clarifications: paramadibuddhavajradhatumahamal!c!ale niranvaye jfianajfieyaikalolfbhute acchedye· 'bhedye sarvakaradhatulak~al!e adarsapratisenatulye / 614

In the great malJ.c!ala of the Paramadibuddha vajra-realm, it [the Paramadibuddha] is without connection (niranvaya), it is the unified mixture of knowledge and objects of knowledge, it is indivisible and undivided, it has the characteristics of the realm of all aspects and is 'similar to a mirror divination (pratisena). 6J5

Here, Paramiidibuddha is a designation of the Kiilacakra ma/Flala, the third meaning of the word in this context. Paramiidibuddha is again qualified with the word niranvaya ("without parts, unconnected") and the word Paramiidibuddha again has a very uncertain meaning. Here it seems to be the malJ.rJala, but how can the malJ.rJala be without parts? It seems that there is a shifting of the meaning and the conceptualized Paramiidibuddha is again showing itself. The mal}rJala cannot be indivisible, etc., because it is a very complex construction. The concept of Paramiidibuddha as "the superior original Buddha" is definitely more applicable at this place in the text. Here follows a very interesting quotation, also from the introductory part of the VP I.2: paramadibuddhadheneti / paramadibuddhaJ:t ekak~al!apaficakaravirrzsaty iikaramayajaliibhisambodhila~al!o '~arasukhaJ:t paramaJ:t tenadibuddhaJ:t paramiidibuddhaJ:t tena paramadibuddheneti / niranvayeneti / anvayaJ:t prajfiopiiyatmako grahyagriihakalak~alJ.o dharmaJ:t so 'nvayo nirasto yena 'sau niranvayaJ:t tena niranvayeneti / kalacakrabhagavateti / kalaJ:t paramak~aro mahiisukhalak~al!aJ:t tenotpaditarrz niravaral)arrz skandhadhatviidikarrz cakrarrz yasya sarfram asau kalacakraJ:t / 616

As for "the Paramiidibuddha": The Paramiidibuddha is the unchanging bliss [which is ]supreme and is characterized by attaining enlightenment in a single instant, in five aspects, in twenty aspects, and by the net of illusion. By that [unchanging bliss] [originates] the Adibuddha and the Paramadibuddha and by that the Paramadibuddha [text]. As for "without parts", "parts" (anvaya) is the dharma that consists of wisdom and method, that is characterized by obj ect and subj eel. Someone who has abandoned that "part" is "without parts." Vimalaprabha 1.2 in VP vol.I. 1986: 16, line 26. Newman. 1987a:268. Here Newman makes remarks concerning two Sanskrit words, pratisena and ekalolibhata that cannot be found in lexicons, but can interpreted with the help of the Tibetan translation. 616 Vimalaprabhii 1.2 in VP vol.J. 1986: 17, line 9. 614

615

108

By that [there is the concept of] "without parts" (niranvaya). As for the Bhagavan Kiilacakra; kala (time) has the characteristics of great bliss and the supreme unchanging (paramiik~ara).617 One whose body is generated as a wheel (cakra) of unobscured aggregates, elements and so forth by means of that [bliss], this is Kiilacakra. 618 This is a very interesting definition of Paramiidibuddha: Unchanging bliss (ak~arasukhaf:t) - perfect enlightenment in a single instant - supreme (paramaf:t). The temporal aspect of Paramiidibuddha is here clearly expressed. Actually, from this verse it seems as though the "unchanging bliss" existed before the Adibuddha. He is also the one who actually taught the tantra in the form of Kiilacakra at Dhiinyakataka stupa. There is also a definition of Kiilacakra in the second part of the quotation. Consequently "Time" (Kiila) has the same main characteristics as Adibuddha, namely "supreme unchanging" and "great bliss". This shows the importance of the concept "time". There is also a defmition of the problematic word niranvaya. The VP text has analysed the word in two parts. Anvaya means the dharma that consists of prajfiii (wisdom) and upiiya (method) and which is characterized by object and subject. Consequently, there are two parts to this concept, a dualistic concept. Nir- in Sanskrit is a negative prefix and consequently niranvaya is something that is not having the two parts wisdom and method. Therefore, it is a good designation for the Adibuddha concept. The fact that Kiilacakra is designated as a "non-dual" tantra here is given a clear motivation. In the following quotation from the introductory part of the VP the problem of the roottantra is treated: dViidasasiihasrikam iii / caturasftisahasriidhikatrilaksaksarasamuham dvatrimiad aksariinustubhah619 dvadasasiihasrikam iii / ~ucandra- . riijiidhye~iten~620 / p~;amiidibuddham iti / paramiidibuddhiibhidheya viicakatvat asyiibhidheyasyiibhidhiinasvabhiivatayii 'vasthitatviid iti / paramiidibuddharrz kalacakram kalacakriibhidheya viicakatviit kalacakriibhidhiinamiti / niranvayam iti niranvayiibhidheya viicakatviit / ihiinvayal;z prajfiiipak~a upiiyapak~as ca / so 'nvayo bhinnapak~o nirasto yasmiit tat tantrarrz niranvayam / prajfiopiiyatmakarrz yogatantram ity advayam ucyate / jineneti /621

Regarding "12,000 verses", it is an assemblage of384,000 syllables. It consists of 12,000 verses in anu~!ubh, which consists ofthirty-two syUables. As I will state at length in chapter six ofthis dissertation, paramiik!'ara (the supreme unchanging) is a very important concept in the Kiilacakra Tantra. The verse (KCT V:127) which contains the concept has a commentary in the Vimalaprabhii consisisting of 100 pages. The concept can in some way be related to the Adibuddha concept. 618 Newman. 1987a:270. 619 I chose here to use the alternative reading given by Upadhyaya in VP vol.1. It better corresponds to the context. 620 In this context, I chose to include a variation from the sDe-dge edition of the bsTan- 'gyur as given by Upadhyaya (p.19). 621 Vimalaprabhii I. 2. in VP vol.!. 1986: 18, line 1-7; Bu-ston's commentary on the VP in Bu-ston. 1965a:335 (Tibetan). 617

109

Thus, [the Paramiidibllddha has] 12,000 verses. It was solicited by king Sucandra. [Why the name] 'Paramiidibuddha'; it is because it expresses the subject, the Paramiidibuddha, since it is established as the topic ofthe description of this subject. [Regarding] the Paramiidibllddha and the Kalacakra; since it gives expression to the subject Kalacakra, it is the designation of Kalacakra.lt is 'without parts' because it expresses the subject that is 'without parts'. Here, "parts" (anvaya) is the side of wisdom and the side of method. By the Jina it is said that the tantra that is without these parts because it has abandoned side, is non-dual. 'It is the yogatantra that is without parts, that consists of wisdom and method.'

622

First the definition of Parama.dibuddha as the name of the text is treated. The VP text itself says that Parama.dibuddha is so called because it expresses the subject, which is Paramadibuddha. The topic of the whole text is in some way Parama.dibuddha. This quotation is very important for the sake of defining the concept Parama.dibuddha, because here it is clearly stated the root-tantra text in 12,000 verses is called Parama.dibuddha, but that the reason for this is that this concept is the most important of the text. Consequently, there exists a concept called Parama.dibuddha and it must be possible to find a content for this concept in the text, the laghutantra, which is said to be an abbreviation of the Parama.dibuddha text. I have not found any systematic attempt in the texts to clarifY what the concept means. The only way to determine more is to investigate different parts of the text where the concept is used. Later, on the same page, the problem that the Parama.dibuddha is "without parts" is treated. It is "without parts" because it expresses the subject that is without parts (niranvaya; rigs med). Here "parts" (skI. anvaya; tib. rigs) is the side of wisdom and the side of method. The Jina (7) says that the tantra which is without that part because it has abandoned side, is non-dual. Parama.dibllddha is, consequently, a concept beyond lIpa.ya and prajfia. representing non-duality. As remarked above (p.76), niranvaya can also be translated as "without causal connection", which is a translation that fits in better with the Parama.dibuddha concept. This passage has, as Newman remarks, given rise to a debate whether Ka.lacakra constitutes a third non-dual class of tantra within the anuttarayoga tantra. 623 It is stated in many places in the Vimalaprabha. that Paramtidibuddha is "without parts" (niranvaya). Perhaps it is a way of saying that the Parama.dibuddha never has had division of wisdom and method. Adibuddha is the bliss united from the beginning! The following is the last quotation from the introductory part of the VP. After this, the verses of the KeT with the corresponding commentaries from the VP commentaries start: tasmi'it prajfiopiiyatmakal[! tantral[! yogatantral[! niranvayal[! kalacakral[! paramarthasatyata iti / vajradharajnanakayasak~ibhatayii ntimasahgity alilihgatam iti / iidibuddhiibhidhanatviit / iha yathii niimasahgitir atftanagatapratyutpannais tathiigatair bha"itii bha"i'f}'ate bhii~yate

622

623

Newman. 1987a:274. Newman. 1987a:274, note 28.

110

tathadibuddham api / adiSabdo 'niidinidhaniirthal;! / aniidiklile aniidibuddhadesitaTfl desayi~ate de§yata iti / naikena sii!cyamunina dfpankaratathagateniiplti I .24 Therefore, from the point of view of absolute truth, Kalacakra is the tantra and the yogatantra that consists of wisdom and method, without parts (niranvaya). 'It is embraced by the Namasangfti that has made visible the wisdom body (jiianakiiya) of Vajradhara' because it is the designation of the Adibuddha. Here, just as past, present and future Tathiigatas spoke, are speaking and will speak the Niimasangiti, just so is that Adibuddha . The word iidi means without beginning or teI1l1ination. Since beginningless time beginningless Buddhas have taught it, are teaching it, and will teach it: it is not taught merely by Tathiigata DfpaT[lkara and Sakyamuni. 625 Here is stated that Kalacakra is a kind of yogatantra and is again "without parts" (niranvaya). Again the connection with Namasangiti is made in the way that Kalacakra is embraced by it. The Namasanglti was very important for the Kalacakra texts and some of the main ideas were possibly taken from that teaching. Present and future Tathiigatas will continue to teach the Namasangiti and Adibuddha texts. Not only the Dfpa1flkara and Sakyamuni Buddhas but many other Buddhas will teach it. The universality of the Kalacakra teachings is established. This passage defines Adibuddha as without beginning in time. The word adi is concretely defined here as without beginning or termination. This then could be an indication for the interpretation of this term. Adibuddha does not mean the one who first obtained Buddhahood, but is the Buddha without beginning or termination, "eternal." The Namasanglti and the Adibuddha have been taught from beginningless time (anadikiile). It is worth notingJere that time is designated without beginning. All this is important in connection with the foregoing passage where it is evident that Adibuddha never has realized the union between wisdom and method, but has always been resting in the unchanging bliss. This and the foregoing quotation can be associated with the idea in Kalacakra of mi- 'pho-ba, "non-transference of consciousness" because there is no real transference of consciousness. There is always a permanent consciousness in the heart cakra. This could be compared to the more general Tibetan doctrine of the "forever indestructible drop" (brtan-du mi-shig-pa'i thig_Ie).626 This comes very close to a Buddhist idea of an atman which is a kind of permanent "soul". The problem has been treated by Ruegg in connection with the notion of tathagatagarbha which comes very close to the concept of atman. Quoting Buddhist mahayana sources, Ruegg comes to the conclusion that they do not claim a brahmanical concept of atman, but have a similar concept of their own which is approaching the brahmanical concept.627 Already in the first two lines of the first verse of the first chapter of the Sri

Vimalaprabhii 1.2. in VP vo1.I. 1986:18, line 20-24. Newman. 1987a:276-77. •2. See Dhargyey. 1985:91. 627 Ruegg. 1992:19-25,44-55. 62. 62S

111

Kalacakra-Ianlra-raja text itself we find the epithets which are given as of Adibuddha in the Vimalaprabha, that is, a quotation from KCT I: 1: sarvajfiiirrzjiiiinakayarrz dinakaravapu~arrz padmapatriiyatiik~arrz buddha'll sirrzhiisanastharrz suravaranamitarrz maslakena prmJamya I prcched rtijii sucandral;z karakamalaputalJI sthiipayitvottamiiizge yogalJI srrkalacakre kaliyugasamaye muktihetor nariiIJiim 111/1 '"

The omniscient one, the wisdom body Uiiiinakaya), the embodiment of the day-maker [sun], the eye spread out like a lotus petal, the Buddha sitting on the lion throne, was worshipped by the best of gods. King Sucandra bowed his head, and placing the cupped palms of his hands on top of his head, he asked for the yoga in the Srf Kiilacakra, for the cause of the liberation of human beings in the time-period of kaliyuga. 629 This quotation gives a vivid picture of how the Kalacakra was preached by Buddha to king Sucandra. It shows that, already from the beginning, Kalacakra was thought of as a remedy against the evil age of kaliyuga when times are getting worse until a change will come and make times better. It is interesting that the age-old Indian concept of kaliyuga is used in a Buddhist text. The eschatological content in the Kalacakra is evident considering the kings of Sambhala and the ultimate war against the evil mlecchas. These lines are actually an enumeration of the first few topics treated in the tantra, but also an enumeration of qualities of the Adibuddha as commented on in the Vimalaprabha 1.1 (VP voU 1986: 1, line 7). At the same time, from the context it is evident that they are also designations of the Buddha sa!cyamuni as it was he who preached the tantra to Sucandra at Dhanyakataka stapa. This indicates the difficulty in trying to find information on the concept of Adibuddha in the text. In any case it seems that the terms sarvajiiii (omniscient) andjiianakaya are used in several places in the lantra for Adibuddha. 630 The following are some quotations from the malatantra Paramadibuddha in the VP commentary on KCT I: 1: sarvajiio jiiiinakayo yo miirttaIJt;!avapuravyayal;z I padmapatriiyatii~al;z srfbuddhal;z'31 simhiisane sthitalJ II

kayaviikcittariigatmii vajrasattvo 'dhidevatii I kiiyaviikcittariigeIJa kayaviikcittamal!t;!ale II abhedyo vajrayogo 'sau kalacakro 'k~aralJ sukhalJ I aniidinidhano buddha 632 iidibuddho niranvayalJ 11 633

The omniscient one, the wisdom body, the imperishable body of '" KCT.l.I; Banerjee. 1985:1; Vimalaprabha 1.4 in VP vol.1. 1986:30, line 24-27.

"9 Translated in Newman. 1987a:319. Newman. 1987a:349-351. In the text the spelling is 'rrbud - dhail , a way of spelling the name of Buddha that I have never seen anywhere else. This could be a hint at the independence of the root-tantra text called Paramiidibuddha. 632 See foregoing note. In fact, all mention of the words Buddha, iJ.dibuddha and Paramiidibuddha in this quotation are spelled in the same way. 633 Vimalaprabhii. 1.4, in vp von 1986:32, line 16-21. 630 631

112

the sun, with the eyes like spreading lotus petals, the Buddha sitting on the lotus throne: II The essence of body, speech, mind and passion is Vajrasattva, the superior deity in the ma1Jl!ala of body, speech and mind by means of body, speech, mind and passion. II This indivisible vajrayoga is Kiilacakra, unchanging and bliss, Buddha without beginning or end, the Adibuddha without parts [without causal connection] (niranvaya).11 6J4 Here the last line is identical with Mailjusrf-niima-sangfti verse 100a. 635 This once more shows the influence from the MNS. In several places in the laghutantra citations are found citations that are said to be from the mulatantra Paramiidibuddha. This particular one is of special interest. The malatantra must have been known by the author of the Vimalaprabhi'i. The verse on Adibuddha from the MNS must also have been known. Actually, there are good reasons to believe that the concept of Adibuddha in the KiiZacakra Tantra is consciously influenced by the MNS. Once again the concept of vajrayoga is not quite clear. Possibly the meaning should be more literal: "This indivisible vajra-union is KiiZacalrra .. .. ", which then means that the following concepts are designations of this vajra-union. Reading the designations in another way, the qualifications of Adibuddha are: Kiilacalrra, unchanging bliss, without beginning or end, he is Buddha and without parts (niranvaya), or as translated by Davidson "without causal connection".636 The following is a quotation from the VP commentary on KCT I: 1:

ekiira-rahasya-padma-dharmodaya-khadhiitu-mahiisukhiiv iisasi11'ghii asana-bhaga-guhya-sa11'jniinii11' madhye naikii ekiirasa11'jnii pradhiinii sarviisii11' sarvakiirasiinyatii pratipiidakatviil / tathii va11'kiiramahiisukha mahiiriiga-sahaja-paramiik~ara-bindu-tattva-jniina-vi§llddhaci/ta­

sa11'jniinii11' madhye na ekii va11'kiirasa11'jnii pradhiinii sarviisa11' mahiimlldriisahajiinandiik~arasllkhapratipiidakatviid iti evamekiira-va11'kiirayo/:! sarviikiiravaropetii siinyatii sarvadharmaniriilambakaru(lii 'bhinnabodhicittabhiivapratipiidakatviil / eva11'kiiro vajrasattvo bodhicitta11' kiilacakra/:! iidibuddha/:t prajnopiiyiitmako yoga/:! jneyajniiniitmaka/:! advaya/:! aniidinidhana/:t santa/:! samiija/:! sa11'vara evam iidyanekasa11'jniibhi/:! prajnopiiyiitmako 'dvayo yogo niranvayo yoginii 'vagantavya iii / 637 Like that, among other designations the E-letter, the secret doctrine, the lotus, the origin of dharmas, space element, abode of great bliss, lion throne, vulva and secret. E-letter alone is not the main designation because all of these demonstrate the voidness of all aspects. In a similar way, among the terms VAM-letter, great bliss, great passion, simultaneously-arisen, supreme unchanging, drop (bindu), essential reality, wisdom (jfiiina) and pure mind. VAM-letter alone is not the main designation because all of these demonstrate mahiimlldrii, simultaneously-arisen joy (sahajiinanda) and unchanging bliss (ak~arasukha). Likewise, the two letters E and VAM shows the existence Newman. 1987a:326-27. Davidson. 1981 :30 incl. note 95, 57; Wayman. 1985:93. See the present work p.76. 636 Davidson. 1981 :30. 6)7 Vimalaprabhli 1.4. in VP vol.!. 1986:34, line 22-29. 634

635

113

that is bodhicitta ,that is, indivisibility (abhinna), emptiness, possessing the best of all aspects and compassion that does not objectify any dharmas. For this reason, a yogi who is to be well judged, should first reach a manifold understanding of the non-dual yoga that consists of wisdom and method without parts [without causal connection] (niranvaya), the letter EVA¥, Vajrasattva, bodhicitta, Kiilacakra, Adibuddha, the one consisting of wisdom and objects of wisdom, the non-duality, without beginning and end, peaceful, Samiija and Samvara. 638 This quotation is of interest from many aspects. First, it enumerates te=s applicable to emptiness (siinyata) in all it's meanings and for the te=s designating unchanging bliss (a~arasukha). Then Adibuddha is enumerated among te=s applied to indivisible emptiness and wisdom and method without parts. All of these te=s are used to explain different aspects of these concepts. The mantras E and VAM are at other places used in the duality correspondences that can be found in chapter five ofKCT and VP. These dualities are treated in chapter 6 of this work (p.l67, 199). They are also on different sides when E is on the side of voidness (siinyatii) and VAM is on the side of great bliss (mahasukha) and unchanging bliss (a~arasukha). The yogi then should understand the non-duality which arises when E and VA¥ are united. On that level of non-duality are also found the Adibuddha, Kalacakra, etc. It can be noted here that Samaja and Salflvara are also mentioned in connection with the non-duality, which means that they also have a similar teaching of the non-duality. Here again is a quotation from the miilatantra in the VP commentary to KCT I: 1: iha malatantre bhagavan aha E-rahasye khadhiitau va bhage dharmodaye 'mbuje I simhiisane sthito vajrf uktastantratare maya II VAfr/-vajrf vajrasattvas ca vajrabhairava fsvara/:l I heruka/:l kiilacakras ca iidibuddhiidiniimabhi/:l II naniivi~ayasamjniibhi/:l sthiinamiidhiiralak~m:zam I iidheyas ca mayii prokto nanasattviisayena ca 11 639

Here, the Bhagavan said in the basic tantra [malatantra: Paramiidibuddha]:In various tantras I speak of Vajrf sitting in the E, in the secret doctrine, in the space element, in the vulva, in the source of phenomena (dharmas), in the lotus or on the lion throne. II I use the names Vam, Vajrf, Vajrasattva, Vajrabhairava, isvara, Heruka, Kalacakra, Adibuddha and so forth. II Using the designations of various lands, in accordance with the dispositions of various sentient beings, I speak of the characteristic of the base (adhiira), the place, and also of the based. II 640

638 639 640

Newman. 1987a:324. Vimalaprabh. I.4 in VP vol.!. 1986:39, line 3]- pAO, line4. Newman. 1987a:354.

114

This is a citation from the root tantra where Buddha speaks of his using different names for the base (a.dha.ra) in different systems of teachings, but that essentially they are the same. Adibuddha is here only used as one of many designations for that concept and in that way does not seem to be very unique or special. There is perhaps a possibility of a doctrinal evolution from the root-tantra to the Vimalaprabha.. The VP is much more definite in defining Adibuddha as a cosmological concept. There has been no real investigation into trying to separate elements in the root-tantra from the KCT and the VP has been done. Newman made an interesting note where he cited two verses from the Vajrama.la., a vya.khya.tantra to the Guhyasama.ja. They are virtually identical with the two first verses from the Parama.dibuddha quoted above. If they are original to the Vajrama.la., it means that the Adibuddha concept could be linked with the Ka.lacakra long before the system appeared openly, as this text is much older than the Ka.lacakra. It would be an interesting challenge to the dating of the system. Newman chose to believe that these two verses are later interpolations in the Vajrama.la.. This is still an open question.64I Concerning the enumeration of names which possibly are linked to the Adibuddha concept, the names Val!!, Vajr!, Vajrasattva and Ka.lacakra are well known from other places in the texts. Vajrabhairava and Heruka are Buddhist deities and can, in their own context, be considered to be of the Adibuddha type of deity. l§vara is, as a more general designation of "god", more of a Hindu concept. The syricretistic character of the Ka.lacakra texts is apparent in many places. The following is a quotation from the VP commentary on KCT I: I: yal; paramiirthasatyena desital; sa lokottara-sarviikiiravaropetamahiimudriisiddhisiidhaniiya svacittaparikalpaniidharmarahital; pratyak~al; svacitlapratibhiiso yoginiil!! gagane pratibhii~ate kumiirikiiyii iidarsiidau praliseniivad iii / i~tiirthaphaladal; phalam ak~arasukhal!! jniinacittam / anayos cittayor ekatva", prajnopiiyiitmako vajrayogo mahiirthal; paramiik~ara iidibuddho niranvayal; kiilacakro bhagaviin vajrasattval; sarvatantriintare prasiddha iii sa eva bhagaviin piiramiliinaye hetulak~a1}e prajniipiiramitiiyiil; sViibhiivikakiiya ity uktal; / '42

That which is taught in accordance with ultimate truth is devoid of dharrnas imagined by one's own mind in order to achieve the transcendental mahiimudrii siddhi that possesses the best of all aspects. Like a maiden's prognostic image in a mirror and so forth, the clear light of the yogi's own mind appears manifest in the sky. It gives the result of the desired aim and the result is the knowledge mind (jniinacitta) of unchanging bliss. The oneness of these two minds [the yogins own mind and the knowledge mind of unchanging bliss]- consisting of wisdom and method, the vajrayoga, the great aim, the supreme unchanging, the Adibuddha without parts (niranvaya), Bhagaviin Kiilacakra - is renowned in all the various lantras as Vajrasattva. This very Bhagavan is called "the essence body" (svabhiivikakiiya) in the Prajniipiiramitii - in the paramitii system that is characterized as the cause.'43 Newm.n. 1987.:354-355, note 48. Vim.l.pr.bha 1.5 in VP vol.!. 1986:42, line 22- p.43,line3. 643 Newm.n. 1987.:367-68. 641

642

115

Here it is stated more or less clearly that Adibuddha is Kiilacakra who is vajrayoga, which is wisdom and method, which is the supreme unchanging (paramiikfara). All of the foregoing is equalled to Vajrasattva. All these concepts are actually different ways ofnaming "the Absolute." There is also a mention of the doctrine of the four kayas instead of three, and where "the essence body" (sviibhiivikakaya) is the fourth. 644 Following this, the verse from the Abhjsamayiilal7lkara that treats the four bodies is quoted. 645 Consequently, this text was well known by the authors of the Kiilacakra Tantra and must have affected them. In the Kiilacakra instructions on the four bodies are clearly taught and this teaching possibly has some of its origin in the Abhisamayiilal7lkara. Here follows another quotation from the VP commentary to verse KCT 1: 1:

asminn asamayer kali yunakti iti kaliyugasamaya/:l tasmin kaliyugasamaye kiilacakrlibhidhline adikadiprajiiopliylitmake yogatantre lidibuddhe niranvaye kalacakram abhidheyaTfl vrijrayogal7l tantrasvabhlivata ylivasthitaTfl adibuddhaTfl PTcchel sucandra iti dharmadeslinli saTflgrahab / '" Since the KA is united with this A collection, the KA is in union with this KA collection. Sucandra asked for the subject that is Kiilacakra, the Vajrayoga and the Adibuddha that is the actual topic of the tantra, in that A collection that possesses the KA line: the Klilacakra discourse, the A, etc., and the KA, etc., consisting of wisdom and method, the yogatantra, the Adibuddha without parts (niranvaya). The preceding is a summary of the dharma teaching.'" Here the consonants (KA) and the vowels (A) are first treated. Consonants and vowels are in union with each other and symbolize other types of union. In this passage, it is again stated that Kiilacakra, Adjbuddha and Vajrayoga are placed on the same level. It is also again stated that Adjbuddha is without parts (or without causal connection) (niranvaya). In other places in the text it is found that Adibuddha is characterized as niranvaya. This word indicates a sort of "transcendence" in the concept of Adibuddha. Niranvaya, is one of the key concepts concerning the Adibuddha concept and I will return to it later. Here follows still another quotation from the VP commentary to KCT I: 1:

etat paramiidibuddhayogam atftabuddhair desitaTfl vartamlinair de§yale 'nligatair de§ayi~ate / atftavartamlinlinligatakiilair atitavartamlin linligatasamayai/:l par~adbhir ity anantlinantabuddhalqetre~ anantlinantasattvliniim anantlinantatathiigatair buddhatvliya sandesito de§yate de§ayi~yatfti / ...

, .. Newman. 1987a:369, note 4. Haribhadra. 1932-35:914. ••, Vimalaprabhli 1.5. in VP vo!.I. 1986:46, line 12-15. ,., Newman. 1987a:382. , •• Vimalaprabhli 1.5 in VP vo!' I.I986:46, line 22-25.

,.s

116

Past Buddhas taught this Paramadibuddhayoga. Present [Buddhas] are teaching it. Future [Buddhas] will teach it. It has been, is being, and will be taught to the entourages of past, present and future times, on past, present and future occasions. Limitless Tathagatas rightly taught it, are teaching it, and will teach it to limitless sentient beings in limitless Buddha fields so that [they may obtain] Buddhahood. 649 Here it is stated that past, present and future Buddhas will teach the Paramadibuddha yoga. By "Paramadibuddha yoga" is probably meant the earJangayoga, which is the yoga system used in the Kalacakra Tantra tex;ts. Consequently, Paramadibuddha in this context means the textual system of Kalacakra as presented in the root-tantra text. A last quotation from the VP commentary to KCT I: 1: ida".. visuddhakrama".. mahamudrCisiddhidayaka".. paramadibuddhe prakata".. pustake likhitam 650

This process of purification that gives the mahamudra perfection, that is evident in the Paramadibuddha, was written down in a book. Here is stressed that the process of purification that is associated with the mahamudra is a system of teaching that was written down in the book of Paramadibuddha, and therefore existed before and independent from the book. This point in the text is just before the so-called Kalacakra manifesto that Naropa wrote over the entrance door of the Nalanda monastery. This text, which mentions Paramadibuddha twice, was treated in chapter 3.2.l.(p.74) in the context of making an analysis of the relationship between the Namasangfti and the Kalacakra texts. Following the order of the texts from the Vimalaprabha, the verses of the KCT (the laghutantra) and their commentary will be treated. The previous points were only found in the introductory part of the VP. Consequently, in the following, I will treat part of the text from both the KCT and the VP. The first place in the abbreviated text (laghutantra) KCT where the word Adibuddha is to be found is in KCT I: 149: duerana".. sadhanartha".. pravarabhuvi lale dharmikiina".. jayartha".. purvokta".. cadibuddhe tribhuvanaguruIJa yat sucandrasya sarva".. I lanmadhye kiiicidatra sphuram iha vi~aye desita".. Ie mayadya svaslhane rakeanarlha".. kuru sakalam ida".. dve~alobhair na surya/:l II 149 11 651

The guru of the three existences previously told all this in the Adibuddha to Sucandra, for the SUbjugation of the corrupted (du~ranam), and so that the righteous (dharmika) will be victorious, on the surface ofthe Newman. 1987a:383. Vima1aprabha 1.6. in VP vol.!. 1986:52, line 1. 651 KCT.I:149 in Banerjee. 1985:37; Vima1aprabhiiI.10 in VP vol.I. 1986:152, line 10; Banerjee. 1959:205. This verse stands as nr. 148 in the commentary by Bu-ston (Bu-ston. 1965a:38). In the translation by Banerjee the verse is also given as 1:148 (Banerjee. 1959:205). The whole of chapter I has one verse less in both editions, 169 verses in place of 170. 649

650

117

splendid earth. From among that, I have clearly shown a little bit to you here today in this land. Do all these things in order to protect your own places, oh SilIYa, not out of hatred or greed. 652 The subject in the verses preceding this one in the KCT was war- machines and different weapons needed to defend Shambhala and other disciples who fully understand the Kalacakra. The attitude to adopt concerning these weapons was that they were to be for the defense of Shambhala, not for attack. There is only a short commentary in the VP which says that the tenn Adibuddha is a reference to the miilatantra Paramadibuddha. The "guru of the three existences" is the Buddha Sakyamuni, as from other places in the text it is evident that it was he who put forward the miilatantra at Dhanyakataka stiipa. Consequently, this mention here does not give any new information regarding the content of the Adibuddhaconcept.

4.2.1.b. Adibuddha in the KCT and the Vimalaprabhii commentary to chapter II Adhyiitmapatala1,l - the chapter on the inner world.

The word Adibuddha is found in some places in the second chapter of the KCT and the corresponding commentary in the VP. This chapter treats the outer and inner functioning of the body, the cakras, channels, winds, etc., and the world as a microcosmos. The first occurrence of the term in the second chapter is in KCT II:56:

eval/l tatradibuddhe 6S3 khakaranrpatayol} devatadevatfntil/l •541 prqjiiopiiyo niSaho bhavati hisamavibhtigo 'rddharatre dinarddhe II yena jiiatal/l svadehe dinanisisamayair masasal/lkrantibhedail} I sa srfman maiijuvajro bhavabhayamathano janmanfhaiva buddhal} II 5611 os, Consequently, in the adibuddha there are 1620 gods and goddesscs;prajiiii and upaya are night and day and they are evenly distributed in the night-half and the day-half. By him this is recognized in his own body, with a division of counting in months and in night-time and day-time. He, the blessed Maiijuvajra who destroys the fear for existence, here in this birth he is Buddha. The Vimalaprabhii commentary to KCT ll:56. 6s6

eval/l siiryacandradevatagalJair ekfbhiltaiS ciidibuddhal/l bhavati I tasminn TransL in Newman. 1987a:576. An alternative is tantradibuddhe. The text actually allows both readings (Baneljee. 1985:57). ". Upadhyaya gives svakiiranrPatayoh, but it seems preferable to have Baneljee's version as it is a way of writing 1620 (Vimalaprabhii/ikii Vol.I. 1986:188). '" KCT II:56; Skt. Baneljee. 1985:57; Vimalaprabha 11.3 in VP VoLl. 1986:188, line 1. Tib. Bu-ston. 1965a: Commentaries to KCT p.61 and to VP p.366. '56 I follow the technical device from Upadbyaya in bis edition to put quotations from the verse in bold letters and the commentaries in normal text. '52

'53

118

iidibuddhe khakaranrpatayor 657 vi'!1satyadhikaJo¢a§a§atasa'!1khyii iii, teJiim devatiidevatiniiTh prajiiopiiyal!' niiiiha iti I yathii sa,!zkhya'!1 prajiiii riitribhiiga!:z, upiiyo diviibhiiga!:z samavibhiigo madhyiihniidarddhariitre arddhariitriin madhyiihne siirddhatrayodasanakJatrai!:z daiiidhikiiJiasatadalJ¢air vii gharikiibhir vii niSiivibhiiga!:z; eva'!1 diviivibhiiga!:z I §rimiill nakJatramalJ¢ale iidibuddhe devatiigalJo nakJatranii¢isa'!1khyiitmako bhagavatokta iti I yathii biihye nakJatragha{ikiibhoga!:z sarvagrahiilJiim tathiidhyiitmani kiiyaviikcittajiiiine Ja¢indriyadharmiilJiim iti / yena jiiiita'!1 svadehe / evam uktakramailJa prajiiopiiyiilmaka'!1 yeniidibuddha'!1 svadehe jniitam!jinaniSisamayailJ sandhyiiprahariidibhedai!:z miisasa'!1kriintibhedair dvadisabhi!:z sa yogi irimiin maiijuvajro bhavabhayamathano janmanihaiva buddha iti laghutantra millatantra devatotpiidaniyama!:z 658 So, through the moon, the sun and the -assembly of gods assembled into one, the iidibuddha emerges. In this iidibuddha there is khakaranrpati, which is to be calculated as 1620. Among these gods and godesses prajiiii and upiiya are night and day. In this ca!culationprajiiii is the night-part, upiiya is the day-part. There is an even distribution from the middle of the day to the middle of the night and from the middle of the night to the middle of the day. One classifies the night with the help of 13 ,5 nakJatras 659 or 810 dalJ¢as 660 or gha{ikiis and the day is classified in the same way. It has been told by the Bhagaviin about the assembly of gods in the iidibuddha; they are in their essence the blessed nakJatra-malJ¢ala 661 As in the outer world there is a use of the nakJatra-counting of hours for all the planets, so in the inner which is made up of body, speech, mind and wisdom, [there is a nakJatracounting of the hours] for the properties belonging to the six senses. By the one who has comprehended this in his own body; in the order which has been told by the one who has understood that, that which to its inner essence is prajiiii and upiiya, is iidibudda, with a classification of time in the time of days and nights, and the transfer of the classification into twelve months. This yogi becomes the blessed Maiijuvajra, he who drives out all the fear for existence, in this birth he is Buddha. This is the description ofthe emergence of divinities in the laghutantra and the malatantra. 662

In this case, I present a translation of the VP as well, as it adds valuable new information. Adibuddha could here stand for something to do with time. The verse is placed in the 2 nd chapter in the 3 rd subchapter (mahoddesa) entitled "The emergence of the niiq.is, of the fight between the cakravartin 663 and the mlecchas 664 and the tantra of the family of 65' Here Banerjee. 1985:57 has svakaranrPatayor. The Vimalaprabhii commentary, chapter II, subchapter 3, in VP Vol.1. 1986: 188, line 5-14. Constellations, stars. 660 DalJ4a means basically a "stick" but here it is used in the context of Indian astronomy as a measure of time (Monier-Williams). 661 Mandala of the star constellation. 662 No~'also translated by Wallace. 1995:235-36. 663 The mythical king that will come to rescue the world in the ultimate war between the king of Sambhala and his enemies. 658

659

119

Ka.lacakra." 665 The verses 48-50 treat the above mentioned" fight and verses 51-60 the arrangements of the deities in relation to the constellations and the channels (na.4f) in the body. From the context it is quite clear that in these verses (vv.56-57) the number of deities and its relation to the subtle body should be discussed. The number 1620 deities is explained in the following verses and depends on the number of channels corresponding to the same number of deities in the Parama.dibuddha mandala. 666 The Ka.lacakra mandala normally contains 722 gods,667 otherwise the best transl~tion would be to identify Adihuddha with the mm:u;1ala. There are also variations in the mwu;1alas in the way of counting the gods. In this case, there is the nak:tatra-mm;cJala, which is a variation with 1620 gods. As it is said in the VP, one can say that there are 810 dm:zcJas in the day and 810 in the night. For the whole 24 hours, that makes 1620 dm:zcJas and correspondingly there are 1620 gods and godesses in the nalqatra-mm:zcJala. The correspondence between the number of gods in the ma1JcJala and the way of measuring time and astronomy is here complete. This ma1J!;lala with 1620 gods is from the lost root-tantra. In the abbreviated tantra, the ma1JcJala contains 722 gods. There are also distinct Ka.lacakra-ma1J!;lalas published in the Ngor collection. 668 It is actually written in this text that the assembly of gods in the Adibuddha is the nak~atra­ ma1J!;lala (the star constellation ma1J!;lala). It is also written in the VP that the 722 divinities in the laghutantra and the millatantra are described, and the 1620 divinities are probably described in the millatantra. To conclude, this verse is states that the Adibuddha is the assembly of gods and godesses in the millatantra. Adibuddha here is a designation for the number of gods in the ma1J!;lala in the root-tantra. A quotation from KCT II:57: trilpsadbhiigena tasmiit triglllJitaniyatii devatiii} Kiilacakre mudrii~a!ka", ca bahya", punar api niyatiiS cakraniiejyas tathaiva I u~1Jf~e dvih669 hrdo '~!au sirasi npatayo dantasa",khyii ca ka1J!he niibhau cii~!a.If!aglllJya dvigu1Janrpatayo guhyamadhye prasiddhiii} 115711 Vimalaprabhii: to KCT II:57:

idiinfm atai} paramiidibuddhiillaghutantrotpiida ucyate tri""ad ity iidinii -iha paramiidibuddhiit vi""aty adhika~oejasasatiit tri""ad bhiigena labdhiii} catupaficiisad devatii bhavantfti I punai} kiiyaviikcittaguIJitiis triguIJii dvii~a~tyadhikasata", bhavati I e~u mii1JcfaleyiiS catui} paficasad adhikasatasa",khyii ma1Jcfalesa", prajfiopiiyayugma", biihye mudriilfa!kam iti I kiilacakra", paramiidibuddhiin nirgatQ/!, dasabhiigeneejiidisa",khinyanta 664 Mleccha comes from the Sanskrit root mlech which means "to speak indistinctly (like a foreigner or barbarian who does not speak Sanskrit)." As a noun mleccha, it means "foreigner, barbarian, non-Aryan, man of

an outcast race, any person who does not speak Sanskrit and does not conform to the usual Hindu institutions." (Monier-Williams, 837). In the Kiilacakra Tantra (KCT I: 150-170 and KCT II:48-50), mleccha stands for the barbarian Muslims from Makha (Mecka). 665 vp Vol.I. 1986:183. 666 vp Vol.I. 1986:184-190; Translation in Wallace. 1995:224-243. 667 See for example the Nilfpannayogiival, and its description of the deities in the Kiilacakra mar.u;iala. 668 Tibetan Mandalas. 1983:plates 97 and 98. 669 Banetjee. 1985 has abdhi which stands for "four" and is more relevant.

120

niit;fibhedeneti biihye neyiirtham iti laghukiilacakra niyamal:z /670 Translation ofKCT II:57: 671 Because of the division into thirty [divinities] from that [Adibuddha], in the Kiilacakra [tantra] there are a determined [number] of divinities multiplied by three. Moreover [there are] the six outer madras and the determined [number] of the channels of the cakras. There are four [channels] in the crown [-cakra], the heart [-cakra] has eight, the fore-head [-cakra] has sixteen, the throat [-cakra] has thirty-two, the navel [-cakra] sixty-four, and in the secret [-cakra] thirty-two [channels] are known. 1157 II Vimalaprabha to KCT II:57: Now, here the origination ofthe laghutantra from the Paramiidibuddha [mulatantra1is presented, beginning with "thirty" and so forth. Here, from the Paramiidibuddha, 54 deities are obtained due to the division of 1620 by 30. They are "multiplied by 3", that is, multiplied by body, speech and mind, and become 162 [deities]. Among them, those related to malJl!ala are 154. The marJt;fala is the pair consisting of wisdom and method and the six mudras in the outer [world]. The Kiilacakra 672 has come forth from the Paramiidibuddha673 due to the classification often,674 that is, due to the classification of channels beginning with it;fa and ending with saizkhini. This is a relative meaning (neyartha) with respect to the outer [world]. This is a description of the laghu Kiilacakra [tantra]. This part of the second chapter contains many figures and calculations of numbers which have their origin from the system of channels in "the subtle body". From the number of channels in the body are also calculated the deities in the mal:u;fala.This verse KCT II:57, with commentary VP voU: 188, has more information on the Paramiidibuddha. The origin of the abridged tantra from the root-tantra is explained. It is a continuation of the reasoning around the number of deities in the marJt;falas. In the Paramiidibuddha there were1620 deities but by a system of division it is reduced and then again restored until the conclusion that the Kiilacakra has come forth from the Paramiidibuddha and they both contain 1620 deities. 675 Again it is clear that Paramiidibuddha is a designation of both the roottantra text and the assembly of divinities in the marJr;iala of Paramiidibuddha. The following part of the VP commentary to KCT II:59 treats the Adibuddha and the

marJr;iala: evalJ'l ~a!paiiciiSad adhikasatakiilacakraniit;fyo devatiidevatlsvabhiiveniivasthitii KCT II:57 and Vimalaprabha II.3 in VP VoL!. 1986:188, line 15-24; Baneryee. 1985:57. This text has been translated by Wallace in her dissertation which translates the whole of the second chapter, both KCT and VP. (Wallace. 1995:236-37). 672 Bu-ston. 1965b:367. Bu-ston gives the explanation "1620" [deities]. 67J Ibid. Bu-ston gives the same explanation "1620" [deities]. 674 Ibid. Bu-ston gives "[often1channels (niiif!) ofthe heart." 675 VP VoL!. 1986:188; Bu-ston. 1965b:64-65; Wallace. 1995:237-38. 670 671

121

biiliiniiTf'l mrtyudiiyikiil;! yoginiiTf'l sukhadiiyikiil;! ~afkulan#fbhil;! siirddhaTf'l bhiivitiil;! satyal;! dvii~a~tyadhikaiataTf'l kiilaeakraTf'l ~afeakran#Yiitmakam iti / tiisll punar dvii~a~tyadhikaiatanii4f~1I pratyekan#f dasaviiyupraeiire/'}a skandhadhiitudasasvabhiivena dasavidhii bhavanti / evaTf'l sarvii daiagu/'}itii viTf'l$aty adhika~o4aiasatasaTf'lkhyii bhavanti saptiiviTf'l$an na~atraghapkiiviihinyal;! / evaTf'l srfmiin na~atrama/'}4alaparamiidibuddhe etiivatyo devatyal;! prqjiiopiiyeneti / ato vistariin na~atramal'.'4aliillokasaTf'lvrtyii sle~miididhiitu­ viihinyo devatii laukikasiddhisiidhaniiya ea sarirasiddhisiidhaniiya vii maiijuiriyoddhrtiil;! ~afeakraniiyikii iti kiilaeakranii4fsaTf'lkara niyamal;! /.16 Thus, one hundred and fifty-six channels of Kiilaeakra, which exist with the nature of male and feIDaIe deities, !Il"e the givers of death to foolish people and the bestowers of bliss to the yogis. They are conceived as good along with the channels of the six families. Kiilacakra consists of one hundred and sixty-two channels of the six eakras. Among those one hundred and sixty-two [channels), every single channel is often kinds due to the circulation of the ten winds and due to the ten natures of the aggregates (skandha) and elements (dhiitu). Thus, all multiplied by ten become one thousand six hundred and twenty [channels) conveying the ghiitikas ofthe twenty-seven constellations. Thus, due to wisdom and method, there are that many female deities in the glorious Paramiidibuddha with its mal'.'4ala of constellations. Hence; conventionally, the deities convey the elements of humours from the extensive mar;u!ala of constellations (nak~atrama/'}4ala). Maiijusrf selected the consorts of the six eakras for the sake of attaining the mundane siddhis, or for the sake of attaining the bodily siddhis. This is an exact description of the arrangement of the channels in Kiilaeakra. 677 Here the concept of Paramiidibuddha represents the mm:uj.ala as presented in the roottantra. There are 1620 deities in the na~atramar;4ala of the Paramiidibllddha text and here is given the very interesting explanation of why there are so many deities in this mar;4ala. In the mar;4ala extracted from the laghutantra there are normally 722 deities. Consequently, this is the explanation of the number of 1620 deities in the verse treated KCT earlier, II:56. Here follows verse KCT II:92 with its VP commentary:

evaTf'l karmiistiviidi bhavati'sa bhagaviin ekasiistii na kartii / sarvajiias ciidibuddhas tribhuvananamital;! kiilacakri na cam // brahmii vi~/'}ui ca rudral;! sara/'}am adhigato yasya piidiibjamale / taTf'l vande kiilacakraTf'ljinavarajananaTf'l nirgu/'}aTf'l nirvikalpaTf'l //92 //678 The Tibetan translation given in Bu-ston, 1965b: 679

De ltar las ni yod par smra ba por 'gyur beom ldan ston pa geig pu de ni byed po min / kun mkhyen dang po 'i sangs rgyas srid gsum gyis btud dus kyi

67. Vimalaprabha II.3 in VP Vol.I. 1986:190, line. 1-9. A commentary on KCT II:59. 677 Wallace. 1995:242. 678 KCT 11:92 in BaneIjee. 1985:66 and in Vimalaprabhli II. in VP Vol.I. 1986:219, line 18-22. '7' Bu-ston. 1965b:137.

122

'khor 10 can te 'khor 10 can ma yin / tshangs pa khyab 'jug drag po dag kyang gang gi zhabs kyi chu skyes drung du Ihag par skyabs'gro ba / dus kyi 'khor 10 rgyal ba mchog bskyed yon tan med cing mam rtog med pa de la phyag 'tshallo /1 92 Thus, even though he becomes the one who advocates the existence of karma (karmilstivadin), 680 so he, Bhagavan the unique teacher, is not one who is a creator. He is omniscient Adibuddha, revered by the three worlds, Ki'ilacakrf [the one with the time-wheel], not Cakrf [the one with the wheel], at the root of whose footlorus Brahma, Vi~l}u and Rudra have found refuge. Kalacakra [who is] thejina-producer, [who is] without qualities, [who is] without mental constructions (nirvika/pa), him I pay homage to. 11921 The Vimalaprabha commentary:

evam uktena kramel}a karmastiviidi karla iti nilstivadf nairalmyavadr bhavati, sa bhagavan viSuddhacittatma I "na sannasanna sadasanna capy anubhaytitmakaf!! [ma akti a5,2] " ekaSiistii traidhtituke na kartii / sarvajnas ciidibuddhaIJ sarvajFiata-sarvaktirajFiata-margajFiata-margaktirajFiatapraptatribhuvallamitaIJ kiilacakri anasravasukhasarvaktiradharmf / lIa cakri vi~l}uJ:t I kutaJ:t ? yato brahmiiVi~l.111S ca rudralJ saral}am adhigato yasya piidiibjamiile, taf!! vande kiilacakram iti so 'haf!! manjusrir jillavarajallallaf!!l/irgulJaf!!l/irvika/paf!! purvoktalaksalJam iti sunyatavadil/iyama!:z I'" I

A translation of the whole commentary: [Now is told about the Karmavada (the doctrine of karma)] Thus, as it was discussed sequentially, one who is advocating the existence of karma, is not a propounder of the existence of a creator, he is one who is advocating the non-existence of self (nairtitmya); that Bhagavan's inner nature is composed of purified mind. "Na sal/nasal/na sadasanl/a capy anubhayatmakaf!!" (rna 0 kit 0 5,2);682 [Trans!. of the quotation: "not existing, not non-existing, not existing non-existence, there is even not nonexistence of the two together. "] He is the unique teacher, he is not a creator in the three worlds. The omniscient Adihuddha has attained omniscience, knowledge of all the aspects, knowledge of the path,685 knowledge of all the aspects of the path,686 and he is revered by the three worlds. Kalacakrf (the one with the wheel), the one who possesses the '"'From here on I place the original Sanskrit word that I have translated between simple parentheses. I use brackets for amendments in the translation. made in order to make the text comprehensible in English. 681 The commentary in Vimalaprabha II.5 in VP Vol.l. 1986:219, line 22-28. '"'This is a quotation from the Mulamadhyamakakiirikii by Ndgiiljuna, cited in order to prove the doctrine of nairdtmya (the non-existence of seIt). 683 ~ "svabhavikakiiya", according to the commentary by Bu-ston. 1965b:137. ,"4 ~ "nirmanakiiya", Bu-ston. 1965b:137. 685 ~ "sambhogakiiya", Bu-ston. 1965b:137. 686 ~ "dharmakiiya", Bu-stan. 1965b:137.

123

happiness without impurities, is not Cakrf, that is, Vi~lJu. [ Why?] At the root of whose foot-lotus Rudra, Brahma and Vi~lJu have found refuge, him I salute as Kalacakra. Thus I, Mafijusrf, 687 salute this one, the progenitor ofjinas,688 who is Kiilacakra, without characteristics, without mental constructions, and who has been characterized of what has been said earlier. This is the precept of a siinyata-viidin (someone following the doctrine of the Void). In the Vimalaprabha., this is part of the 5 th subchapter "The definition of the characteristics of the momentary in the Ka.lacakra.,,689 Earlier in this subchapter (v.89) is discussed that "there is no creator who gives or takes away the happiness and sufferings of living beings. In sarrzsa.ra, a performed earlier deed which is of three kinds brings about its result. ,,690 It is important to stress that there is no "creator" of the individual. Generally, it is argued here for the doctrine of karma and its general validity. The general topic is the birth in the six destinies due to the ripening of karma. Here Adibuddha stands for the "principle" of Adibuddha. In this verse one can read that he is omniscient,691 he is revered by the three worlds, and he is equal to Ka.lacakra who produces thejinas. Also, one who advocates Ka.lacakra is not a worsrupper of Vi~IJU.692 This is a very interesting verse where for the first time in the KCT the word Adibuddha is given some qualifications and is not just a name for the texts in the Ka.lacakra Tantra. In the commentary it is made clear that Cakrf is Vi~lJu, wruch means that that the followers of Ka.lacakra did not want their teacrung to be mixed up with vai~lJavism. The whole verse makes it evident that Ka.lacakra is considered superior to the greatest Hindu gods. Actually, these gods (Brahma, Vi~lJu and Rudra) have taken refuge in Ka.lacakra. To conclude, in trus verse one can say about the Adibuddha that "he ?,,693 is omniscient, has attained knowledge of all aspects, has knowledge of the path and all aspects of knowledge of the path, and is revered by the three worlds. He is also to be equalled to Ka.lacakra, who is ajinajanaka (he makes thejinas emerge). I use here the pronoun "he", but of course Adibuddha has no gender and is neither "he" nor "she". It is also impossible to say "it" and I use "he" as a convention in this work. It is clear that Adibuddha is beyond male and female. zfWhen in the fmalline of the commentary it is said that trus is a fixation of the sunyata-va.da (the doctrine of the Void), the reader could start wondering what these deities really are in connection with the doctrine of the Void. Perhaps this verse is another way of describing the sunyata.-doctrine of the Void?

6"He is Yasas, king of Sambhala and father of the author of the Vimalaprabha, who is considered to be an incarnation of the bodhisattva Maiijusri. '" = "Vajrasattva", Bu-ston. 1965b:138. 68' vp vo!.!. 1986:214. 690 vp vol.1. 1986:218; Wallace. 1995:325. 691 Newman. 1987a:349-351 for a discussion ofthe concept "omniscient". 692 Later in this 2" chapter of the KCT is found a discussion of the doctrines of Kalacakra and Madhyamika contrasted to other schools and religions in India at this time (9~ to II th century). KCT II: 161-180; VP VaLl. 1986:255-271; Wallace. 1995:428-473; Gronbold. 1992b. 693 It is of course impossible to give the concept of Adibuddha a gender. I have written "he" in the text only following the tradition that masculinity has a sort preference. One of the definitive qualifications of the Adibuddha is that "he" is beyond the dualistic concept of gender.

124

In the commentary there is inserted a verse from Nagarjuna in order to strengthen the fact that the description of the deities has its basis in Madhyamlka philosophy. Next, I will present a part of the VP commentary to the verse KCT II: 176 which contains a mentioning of Adibuddha:

vistaro 'neko 'nekapramal;lasiistrel;la madhyamakena nirakaral;lfyas tirthilriinalp siddhantaf} I yaf} salpvrtya vivrtya va sambuddhavacanasamaf} sa na dii~al;lfya iii lriilacakra adibuddhabhagavato niyamaf} I tadyatha -- ,.. The extensive and diverse system (siddhanta) of heterodox sectarians (tirthikas) is to be repudiated by means of the Miidhyamika, which has many authoritative treatises. That which is either conventionally or nonconventionally identical to the words of the Buddha, is not to be refuted. This is the defmition of the Bhagavan Kiilacakra, the Adibuddha. For example ... Here is clearly stated that Kalacakra is A.dibuddha. After the fore-going verse the concluding verses 177-180 ofthe second chapter on the inner Kalacakra (Adhyatmapa{ala) follows. Kalacakra is here consequently called A.dibuddha and these last verses seem to a listing of characteristics of KalacakralA.dibuddha. These verses do not have any commentary in the VP, but concerning the two last verses of the second chapter. Here follows KCT II: 179:

indro ahalp svargaloke tridasanaragurur bhiitale cakravartf piitiile niigariijaf} phal;likulanamitaf} sarvagas cottamo 'ham I jiianalp buddho munindro '~araparamavibhur yoginiilp vqjrayogo vedo olplriiraJ:t pavitro vraja mama Saral;lalp sarvabhavena rajan II 179 II'" I am Jndra, the guru of thirteen in heaven, a cakravarlin on earth, the king of nagas in the underworld, revered by the family of serpents. I am the omnipresent and excellent knowledge (jiiiina), a Buddha, Jndra [the master] ofthe wise men, an unchanging and supreme sovereign (~araparamavibhu), the yogis' vajrayoga, the Veda, the orp.-syllable, a protagonist [chosen by each side to decide a battle] and a means of purification. Oh King, take refuge in me with all your being. Who speaks here? It is not completely clear, but from the context it can be concluded that it is Buddha Siikyamuni in the form of Kiilacakra, and consequently, Adibuddha. A number of characteristics are then enumerated which are the same as those that can be found in other places in the KCT and the VP. He is "unchanging" and "supreme sovereign", concepts that are known from chapter five (KCT V: 127). It can be remarked that Buddha here calls himself "Indra". The "King" mentioned must from the context be identified with King Sucandra of Sambhala who was listening to Siikyamuni Buddha preaching the root Paramadibuddha Kalacakra Tantra and later was to write it down. ". Vimalaprabhii 11.7 in VP Vol.L 1986:270, line 9-10. A commeritary on KCT 11:176. '" KCT 11:179 in BaneIjee. 1985:86 and in Vimalaprabhii II. in VP Vol.I. 1986:271.3 These verses were translated into English byVesna Wallace. 1995:473-474.

125

Finally, the last verse in the second chapter KCT II: 180 will be quoted:

tvaT!' miitii tvaT!' pitii tvaT!'jagati gurur api tvaT!' ca bandhuJ:! sumitraT!' tvaT!' niithastvaT!' vidhiitii hita maghaharalJa tvaT!' padaT!' sampadaT!' ca 1 tvaT!' kaiialyaT!' padaT!' tvaT!' varagulJaniiayo dhvastado,as tvam eva tvaT!' diniiniitha cintiimalJir api saraIJaT!' tvalJ1. gato 'haT!' jinendra 111801/ 696 You are the mother, you are the father. In the world, you are the guru, you are a relative and a good friend. You are a protector, you are a giver, you are the gift of goods and wealth and the state of perfection. You are the final beatitude, you are the abode of the best qualities, and you are free from faults. Oh protector of the wretched, you are the cintiimaIJi.697 I take refuge in you, oh Jinendra (lord ofjinas). This verse is a homage to KalacakralAdibuddha and tells of the qualities of this deity in very concrete language. He is a very perfect, almost human, figure, being the father, mother, guru, protector and free from faults. CintamOlJi is a very precious jewel or stone kept in Kalapa, the capital of Shambhala. The only more general qualification is as "Jinendra" (jina+indra), which in this context can be interpreted as "master ofjinas" or "Lord of jinas".

4.2.1.c Adibuddha in the KCT and the Vimalaprabha commentary chapter III Abh4ekapa{ala/; - the chapter on the initiation.

In a few places in the third chapter of the Vimalaprabha, the word Adibuddha or Paramadibuddha can be found. Mostly, it is no more than the designation of the root-tantra text called with these names. When quoted, the root-tantra is almost always called the "mulatantra", that is, "root-tantra" and only in a few places is it designated as Adibuddha. In the VP commentary on KCT III: 1: tathiiha bhagaviin iidibuddhe.

698

So it was said by the Lord (Bhagaviin) in the Adibuddha. Then follows a quotation from the root-tantra. It is clear that this mentions the text Paramadibuddha, also called only Adibuddha. Bhagavan here, as in most places in the Kalacakra texts, is a title for Buddha sakyamuni. In the VP commentary to KCT III:19.

tatriidibuddhe cittama1J4alaT!' dviidasahastaT!' prakuryiid iti niyamac KCT 1I:180 in BaneJjee 1985:86 and Vimalaprabha II. VP Vol.!. 1986:271. A "wishfulfilling jewel" that was thought to exist in Kaliipa, the capital of Shambhala. It was said to be able fulfill all wishes. 698 Vimalaprabha III. I in VP VoU!. 1994:2, line 2. 696 697

126

calur visali haslarr sulram /

699

In that Adibuddha the rnind-mm:u;iala and the twelve hands are produced, and from the four rules is established the sulra of the hand.

Here Adibuddha is probably the mm:u!ala which is another meaning of the word .. There is nothing new about the concept. In the VP in the introduction to subchapter 3 and KCT III:36 on the drawing of the mm:u!ala: iha paramiidibuddhiid uddhrlarr mm:u!alalak~afJQ1!l paficatrirrsal tam iidivrttaif:z Sangflarr mafijusriya yat tad idanfrr vitanyate mulalantranusarelJa 700

Here, drawn out from the paramadibuddha are the characteristics of the malJ¢ala, the 35 that exist from the beginning, the chant of Mafijuirfwas laid out following the root-tantra. Here the word Paramadibuddha must be a designation of the text, the root-tantra. Here is the same wordingparamadibuddhaduddhrtaJ?'l as found in the commentary to KCT V:89 that will be treated in chapter V. In the VP commentary to KCT III:55: evarr dviidasadvaralmakarr kayavakcittamalJ¢ala1!! paramadibuddharr eo¢asacandrakala vibhagikam / 701

So, composed of the twelve openings, the body, speech and mindmalJ¢ala, the paramadibuddha and the differentiation of the moon

into sixteen moon digits [small parts of the day1 This is a part of the subchapter with the description of maJ;lt/alas in the Kalacakra, so paramadibuddha is again the maJ;lt/ala.

In the VP commentary to KCT III:97: Paramiidibuddhe anye va malJ¢ale saptabhieekair vyakrto anujfiato maya ... 702

In the other Paramiidibuddha or malJ¢ala, having made the seven initiations known by me ...

Here once more Paramadibuddha signifies the malJt/ala in the root-tantra. In the introduction to the VP subchapter 5 to KCT III: 104: iha srfparamadibuddhal pratieravidhir mafijusriya caturdhikasatadivrttair 699 700 701 702

Vimalaprabhii lJI.I Vimalaprabhii III.3 Vimalaprabhii lJI.3 Vimalaprabhii IIIA

in VP VoU!. in VP Vo1.II. in VP VoU!. in VP Vol.II.

1994: 17, line II. 1994:44, line 10. 1994:57, line 17. 1994:93, line 10.

127

uddhrta ifkayii vitanyate 703

Here, Manjusrf drew out the consecration rite from the Srfparamiidibuddha using the 104th verse [ofKCT YJ. I shall explain it with the commentary. It is obvious that Paramiidibuddha is mentioned as the text with that name. The commentary was written with this root-tantra as a base. In the VP commentary to KCT III: 165: yeniitra paramiidibuddhe sarvaprthvfvyiipakatviid bho!!iidicfniidivi~aye~ api pifhiidini santi, ... 704

Therefore, in the Paramiidibuddha from the whole earth .... ; even in the countries of Bho!!a etc (Tibet) and Cina etc, there are provinces etc.... Here Paramiidibuddha is probably a designation for the text Paramiidibuddha. It appears that the spread of Paramiidibuddha to countries like Tibet is mentioned. 4.2.1.d. Adibuddha in the KCT and the Vimalaprabhii commentary to KCT IVSiidhanapfl/alaq - the methods o/practice chapter.

The first quotation is from the introduction to KCT N: 1: Paramiidibuddhiit siidhaniipafa1e sucandriidhye~a1:zaTfl ... 70s

In the chapter on method (siidhana) from the Paramiidibuddha teachings of Sucandra ....

As in most places, Paramiidibuddha is the name of the text. The following quotation is from the VP commentary to KCT N:19 and belongs to the subchapter on the stage of generation and Adibuddha stands for the text. idiiniTfl niimariipiidyutpiidiiya mahiiriigavaineyasaptalokam iidibuddhadesiiniiyiiTfl bhiijanam abhisaTflVlqya suratadhvaninii svakiiye 'k~obhyiidijinasamiihaTfl praveSyiikiiSiididhiitusamiihaTfl pu~avidyii caqur iidiriipiidivi~aya svabhiivena devatii svariipiivirbhiitaTfl punar api taTfl svakiiyiin nisciirya visvamiitari yathii vadantar bhiivayet 1

Here by the first emergence of name and form, [someone] has come to Vimalaprabha ffi.s Vimalaprabha 111.5 70S Vimalaprabhii N.1 70' Vima1aprabhiiN.2 703 704

in VP Vol.il. in VP Val.il. in VP VoU!. in VP VaU!.

1994:98, line 18. 1994:128,line 3. 1994:149,line 22. 1994:162, line 24.

128

be known as the one who takes part of the instruction of Adibuddha on the seven worlds and the modesty of the great passion. In the own body, because of the great pleasure, Alqobhya and the otherjinas are assembled, as well as the realms, space,.etc ... the knowledge of man, the eye, the abode ofthe own form etc. Again, having manifested [this] by his own body, he is to be one who has declared this to Visvamata. The following is the VP commentary to KCT N: 133:

sadhital} Kalacakral} samasukha1!l dadatfli niyama iii srimad adibuddhasadhanam utpannakramelJoktam asya vistaro jiianapafale vaktavya iii II 13 707 The meditation deity Kalacakra has given the same bliss. It is fixed. The holy Adibuddha sadhana, through the stage of completion (utpannakrama) it is to be treated in detail in the chapler on knowledge

(jiianapafalal}). The above is about the siidhana of Adibuddha. There are many ways of practising and making a siidhana in the Kiilacakra Tantra. Here, one is mentioned concerning the completion stage of the initiation and practice following the six folded yoga (~a¢angayoga). Below follows a commentary to KCT N: 168:

adibuddhe mahatantre sugatene~fasiddhaye II eva1!l ~a¢lak~ajapena piirvaseva nigadyate 1708 In the great tantra Adibuddha, the Buddha (sugatena) said that the desired accomplishment [is reached] by the murmuring of the 600.000 [mantras], the preliminary service [lib. sngon- 'gro] This is a quotation from the root-tantra, Which is normally called Adibuddha or Paramiidibuddha. Here it appears that Adibuddha represents the text, but it seems strange that in the very text that is called Adibuddha it is mentioned that something can be found in the text Adibuddha.

4.2.1.e. Adibuddha in the KCT and the Vimalaprabhii commentary to chapter V - Jiiiinapalala/J. - the chapter on knowledge.

The places in the fifth chapter of the KCT and the Vimalaprabhii where the word Adibuddha or Paramiidibuddha can be found will now be treated. In the commentary to KCT V:9:

7.7

7.8

Yimalaprabhii N.3·in VP Yol.II. 1994:219, line IS. Yimalaprabhii N.5 in VP YoU!. 1994:234, line 26.

129

iti viicaniit nedam upiiyatantra1J! bhavati / tathiidibuddhe 709

"

From these statements it is not an upiiyatantra / like that, [in thel Adibuddha [it is said]: After this quotation follows a citation from the root-tantra. Consequently, by Adibuddha is only meant the root-tantra text Paramiidibuddha. It is sometimes called Adibuddha but mostly Paramiidibuddha. The VP introductory commentary to the second subchapter on the four bodies of the Buddha and to KCT V:89: Na san niisan na sadasan na ciipy anubhayiitmakam I catu~kotivinirmuktalJl natvii kayalJl mahiisukham /1 uddhrtalJl mafijuvajrelJa iidibuddhiin niranvayiit / lak~ar.zalJl buddhakiiyiiniilJl caturlJiilJl tadvitanyate 1/ 710

The body of the great bliss is completely liberated from the four alternatives; it is not existent, not non-existent, not existent and non-existent and not consisting of neither. I will explain the characteristics of the four Buddha bodies as Mafijuvajra extracted them from the Adibuddha without causal connection.7l! This is a very interesting quotation that will be returned to when treating the theories of the four bodies of the Buddha.712 The quotation is placed as a sort of introduction to the subchapter on the four bodies and contains at the beginning a quotation from the Millamadhyiimakakiirikii by Niigiirjuna on the existence and non-existence of phenomena. It then continues that Manjuvajra has drawn out the characteristics of the four bodies from the Adibuddha. Here the word Adibuddha can be interpreted in distinct ways. The first is that it quite simply is the name of the millatantra Paramiidibuddha and Manjuvajra is another way of qualifying the author of the laghutantra (KCT) who was the king of Sambhala called Manjusrf Yasas. The interpretation would then be that the author, Manjusrf Yasas, drew out the essential content on the four bodies as written by king Sucandra in the lost root-tantra Paramiidibuddha. The other possible interpretation is that here is meant the concept of Adibuddha as a sort of cosmic idea of the origin of the world, and that the four bodies are levels of existence of the "cosmic" Buddha as well as different kinds of states to be reached in Buddhist methods of realization of the ultimate stage of mahiisukha or nirviiIJa. This interpretation is based on the word niranvaya or "without partiality", "without retinue", "without family", "without descendence", "without continuity", "without relation" or "without causal connection". All these possible interpretations of the word hints that Adibuddha should be interpretated as the "cosmic" Adibuddha and not as the roottantra text.

Vimalaprabha V.I in VP Vol.lI!' 1994:7, line 7. A commentary on KCT V:IO. Vimalaprabhii V.2 in VP Vol.III. 1994:45, line 14. An introduction to the verse KCT:89. 711 A quotation from the Miilamiidhyamakakiirikii by Niigiirjuna. The same quotation exists in the VP commentary to the KCT I1:92 as I have translated it above, p.123. 712 See the translation of the whole of the commentary to verse KCT V:89 in my chapter on the four bodies. 709

710

130

The VP commentary on KCT V:127 in the third subchapter on the supreme unchanging gnosis: kalla puna/.t sal!lbhalavi~aye yasobriihmmJasya putro bhatvii viisudeva/:! sailiiSvam iiruhya darbhamayai/:! sallai/:! sarvamlecchiin miirayitvii bahusuvar!}amedhayiigal!l krtvii punar brahma!}am~YII!l prthvll!l kari~yali / evam anekaviikyiiny agharitiini dll~taviprair buddhotpiidakiile racitiini priigvedapiithe na santi / ihiidibuddhadesaniikiile tathiigatenoklmn lokadhiituparale (1.26) jyoti~aprastiive mlecchadharme jiite sati siddhiiniil!l viniiso bhavi~yati prthvyiil!liaghukara!}iini bhavi~yanti maiijugho~o 'pi mayi nirvrte ~a(ivar~asatai/:! sambhalavi~aye siikyakule sureSiinasya putro vijayiidevlgarbhe yasoniimakalla bhavi~yati / tad yathii. 713

Moreover, the kalkin, after having been born as the son of the briihma!}a Yasas in the realm of Sambhala, [being in fact] Viisudeva, after having mounted on a horse with precious stones, after having killed all the mlecchas with a spear oflong sacrificial grass. After having made an offering ofthe richly golden sacrificial broth, he will once again make the earth the brahma!}a 's place. In this way, by many nonsensical statements were preached by evil brahmans at the time of the emergence of the Buddha, they [the statements] did not exist in the earlier Vedic texts. In this regard, at the time of the instruction of the iidibuddha, it was stated by the Tathiigata in the chapter on the outer world that when, at the proper astrological time, the barbarian dharma is produced, the destruction of the siddhas is going to come; the laghu-kara!}iini [unreliable astronomical calculation manuals] will come into existence on earth, and even Maiijugho~a, six-hundred years after I have entered Nirvii!}a will be [born] in the reahn of Sambhala, in the Siikya clan, as the son of Sure§iina, in the womb of queen Vijayii, is going to become the Kalkin by name of Yasas as follows: Here is written about Adibuddha as the text and it is also told about the author of the text. The use of the concept "instruction of the Adibuddha" signifies that the teaching of Ktilacakra was practised. The VP commentary on the KCT V: 130: Paramiidibuddhe ~a~tisiihasrikiiyiil!l (fkiiyiil!l jiiiitavya iti /

714

It is going to be known in the Paramiidibuddha and the 60,000 verse commentary. This is a reference to the root-tantra written by Sucandra and the 60,000 verse root- Vimalaprabhii commentary. What is interesting here is that both texts are mentioned as existing. The VP commentary on the KCT V:222: athadibuddhokto golakabandha ucyate 715 713 114

Vimalaprabhii V.3 in VP Vol.III. 1994:96, line ]0-16. A commentary to verse KCT V:127. Vimalaprabhii VA in VP Vol.III. 1994:105, line 12. A commentary to verse KCT V:130.

]3]

So, it was said by the Adibuddha and it was expressed in connection with the celestial sphere. Here the word Adibuddha seems to be a designation of the text, or it could be the principle. The VP commentary on the KCT V:223:

iidibuddhabhagavaloktam apararrz vistararrz na likhitam 1122311

716

It was said by the Bhagaviin Adibuddha, otherwise the

exposition was not written. Here Adibuddha can be interpreted as the Buddha Siikyamuni who as Kiilacakra taught the Adibuddha text to the king Sucandra of Sambhala. If it was not preached by the Buddha, it would not be written as a canonical text. As Adibuddha is qualified as Bhagavan, it must be a personal concept. The next mention of Adibuddha is in KCT V :243:

sarvasmirrzslantrariije khalu kulisapadarrz gopitarrz vajril:rii vai, ciidibuddhe nigadilam akhilarrz priilJiniirrz mok~ahelol; 1 tasmiit lantrottararrz vai sakalam avikalarrz lokalokottariibhyiirrz, srfmat tantriidibuddharrz paramajinapates ciibhidhiinarrz sucandra 11243// 717

pratyak~arrz

In all [other) tanlrariijas,718 the vajra-state

is hidden by vajrilJii. For the sake of the liberation of the beings, all is announced clearly in the Adibuddhal Therefore, the excellent tantra [exists), the entire, unspoiled, with the worldly and the outer-worldly. So, srfmat tantriidibuddham is the exposition of the supremejinapati (master ofjinas), Oh, Sucandra. 11243 II Bu-ston does not comment on this verse. Buddha Siikyamuni is speaking to Sucandra about the very text, the mulatantra Paramiidibuddha, which is here called tantrariija. Here Adibuddha is mentioned twice in the same verse. The first time it seems to be the text Adibuddha, that is, the KCT or the lost root-tantra. Everything is said clearly in the Adibuddha texts. The second mention of Adibuddha in the 4th line is very interesting because here there is a confirmation that the much used term jinapati is a designation for Adibuddha. It also indicates the sense of the word as the master or father of the fivejinas, which is the very definition of the Adibuddha. In an incomplete inventory of the termjinapati in chapters 3-5 in the laghutantra, I have found it mentioned in 42 places. Whereas the term Adibuddha is mentioned only 7 times in a complete inventory of the whole laghutantra. This is just one example that there is much more material on the concept of Adibuddha in the tantra than the word itself indicates.

Vimalaprabhii VA in VP Vol.IlI. 1994:139, line 30. A commentary on verse KCT V:222. Vimalaprabhii VA in VP Vol.III. 1994:141, line 17, A commentary on KCT V:223. 717 BaneIjeeI985:260, Vimalaprabhii VA in VP Vol.I1L 1994:150, 718 See Bu-ston's commentary to KCT V:252 in Bu-ston, 1965a:290. 715

716

132

Translation of the Sanskrit and the Tibeta,n of the Vimalaprabha commentary to KCT V:243:

tad eva pratyalqa/'fl cadibuddhe nigaditam akhila/'fl priir;zina/'fl sa/'flbhalavi.aye janminii/'fl nirahahlciiracittiinii/'fl molqahetol} / tantrottara/'fl vai sakalam avikala/'fl tantrariija/'fllokatantriit kriyatantriit, lokottariid yogatantriit, tiibhyiim uttara/'fl lokottottaram / srimat tantriidibuddha/'fl paramajinapater jiiiinalciiyasya sahajasyiibhidhiina/'fl viicakam /1243// 71 • Just so, [it was]clearly [stated] in the Adibuddha, for the sake of the liberation of the ones being born with minds having no pride and for all the living beings in the realm of Sambhala: Actually, the extraordinary tantra, the tilntrariija entire and divided in portions, from the lokatantra and the kriyatantra and from the extraordinary yogatantra of all those it is the supremely extraordinary. Srimattantriidibuddha [KCT] pronounces the full expression of sahaja and the wisdom body (jiiiinakaya) ofthe supreme master of jinas (paramajinapati.) II 243 II The commentary is quite enigmatic. In the country of Shambhala someone, who is probably the author of the Vimalaprabha, PUlJqarika the king of Shambhala, is making a statement with the meaning that the text Adibuddha explains the sahajakiiya and the jfianakiiya of the Paramajinapati. The word Paramajinapati carrys the meaning that it is someone who is the supreme master (or father) ofjinas. On the other hand there can hardly exist more than one jinapati, so consequently the name probably is there to underline the importance of the deity that is the ruler over thejinas. Thejinapati then must be a designation for the chief among the jinas who is- given several names according to tradition. In the Kalacakra context, it seems to be the Adibuddha, Kalacakra, Vajrasattva, Mafijusri and sometimes Samantabhadra. If there is an Adibuddha concept in the Kalacakra, one of his abilities must be to be the father of the fivejinas. Consequently, here Adibuddha should be qualified as the superior fatherlmaster ofjinas. No one else could have this function. For the first time, it is also possible to connect the idea of Adibuddha with the four body theory clearly found in the Kalacakra Tantra. Here it is stated that in some way the paramajinapati "has" a jfianakiiya and/or a sahajakiiya. Jfianakiiya is a concept that is normally linked to Mafijusri as Adibuddha, but in the Kalacakra texts, many times Mafijusri comes very close to be designated as Adibuddha. As will be shown later in this work, Sahajakiiya is definitely very close to the Adibuddha concept in the Kalacakra Tantra. Consequently, it can be deduced that by the term Paramajinapati at this point could be meant a concept of Adibuddha. The next text consulted is KCT V:252 with the Tibetan commentary by Bu-ston. There is no VP commentary on this verse:

srimiin srfdharmacakre suravaranamite vi.tare viivavarr;ze 71. The Sanskrit text in Virnalaprabhii Vol.IIl. 1994:150, line 28 to lSI, line 3. Tibetan: Bu-ston. 1965a:290, line 2-7.

133

tasmin buddhopavi~fo gadati narapate tantrariijiidibuddhatn I candraprasniivabodhe tridasanaragurur yac ca sattviirthahetos lac cediinf", mayii te gaditam api kaliipe 'lpatantra", hi surya. 1/25211 720

Translation with the commentaries of Bu-ston interpolated: 721 Srfmiin, [Bu: This is the place where the Kiilacakra was preached, Dhiinyakaraka stupa], in the blessed dharmacakra [Bu: here is question ofthe gods in the malJt;iala] which [Bt!: the lion-throne] is adorned by the best of the gods; all the colours have been widespread. [Bu: The colours are of various sorts] Buddha [Bu: Buddha Siikyamuni] has, mounted on the wheel, explained to the master of men the [Bu: the mula-] lantrariijiidibuddha", [Bu: the 12,000 verse one, the king among all tantras, the Adibuddha]. For the sake of the living beings and the guru of gods and men, having knowledge of the moon. By me [Bu: Maiijusrf] this is now pronounced [Bu: the meaning of the root-tantra] in the small (alpa)tantra in Kaliipa, [Bu: upiiya and prajiiii are inseparable from the small Kiilacakra-tantra (the laghutantra)] oh, Surya[ratha].

In this verse, the word Adibuddha once more signifies the text, the malalantra Paramiidibuddha. Probably just to make the point that the author, Yasas, composed this text and that the other malatantra was exposed by Buddha himself for the master of men, which probably makes allusion to the king of Sambhala, Sucandra. Here the laghutantra is caned the alpatantra (the small tantra) which is a new terminology. Bu-ston's translation of the Vimalaprabhii ends with verse 247 as there are no commentaries written in the VP on the rest of the verses in the fifth chapter. The last place where the word Adibuddha is found is in KCT.V:256: vrddho 'pi tva", kumiiral; sakalajinasuto 'py iidibuddhas tvam iidau, strfsangf brahmaciirf paramakarulJayii lokabandhur yamiiriQ I saumyo 'pi tva", suvajrf maralJabhayaharas tva", sadii miiramiiro, mukto 'pi tva", bhave 'smin pravisasi jagatal; piicaniirtha", yasas tvam 1125611 722

As there is no commentary to this verse· in the VP, I have translated Bu-ston's. interesting commentaries to the KCT, here presented within brackets: Even though you [Maiijusrf] are old, you are a youngster; even though you are born by all the jinas [you are the son of the jinas because you have entered upon the way of the bodhisattva], so were you in the beginning [that because you have been transformed into the jiiiinakiiya of all the Tathiigata's you are the iidibuddha] iidibuddha.723 Even though you are attached to women, you live in chastity [You are KeT. V:252, BaneJjee. 1985:262 and Vimalaprabhii V.4 in VP VoI.III. 1994:153. Bu-ston. 1965a:294, line 3-5. 722 Sanskrit: BaneIjee. 1985:263; Vimalaprabhii V.4 in VP VoWl. 1994:153. Tibetan: Bu-ston. 1965a:295, line 7 to p.296, line 4. '" These two lines have been presented and translated already by de La Vallee Poussin. 1908:95. 720 721

134

a brahmacari that doesn't let his bodhicitta flow out], with the extreme compassion, the kinsman ofthe world; the enemy [and killer] of yama. Even though you are radiant as the moon [As for you, even though dispassionate(calm)], so [you are] a brilliant vajra, [you] take away the fear for death, always, [you] killer of Mara; [Bu-ston here translates: "As for you, [you are] at each time the killer of Mara"; and (Bu-ston' s commentary: Because you have subdued the Maras who hindered the highest bodhi)]. Even though you are liberated in this world [Bu-ston's translation: "As for you, even though you are liberated (from the ties of life),] as for in this life, (you have come) for the sake of ripening the living beings"], you enter into the worlds to cure the world, you Yasas [As for you (Manjusrf) Yasas, you were made to enter into perfection].724 Manjusri Yasas is here presented as a very complicated personality. He is old and young; he was born by the jinas, but was in the beginning Adibuddha. He is the killer of Mara and Yama; he is not of this world, but enters the world to help it. All this is possibly a way of saying that Mailjusri Yasas is omniscient, and, as is known from the text Mailjusri-namasangiti, he is regarded at times as Adibuddha himself. It is possible that the Yasas which is mentioned is the king Yasas, the author of the text KCT, who in his tum is regarded as an incarnation of the bodhisattva Mailjusrl. There are some problems with this identification though, because if we regard the king Yasas of Sambhala as the author of the text KCT, it seems more than strange that in the very text the author himself is put on equal footing as the Adibuddha. The speaker in this verse is Suryaratha, and some verses in the KCT are dialogue of Yasas and Suryaratha, and consequently these verses are not drawn from Paramadibuddha. This is Suryaratha 's praise of Yasas. According to Bu-ston the interpretation could be that all the former part of the verse makes allusion to the bodhisattva Mailjusri (as Adibuddha), and that only the final salutation alludes to the king Yasas. Bu-ston comments that Mailjusri is the jilanakiiya of all the Tathagatas and thisjiianakiiya can be said to be the Adibuddha. Furthermore, two more places where the word Adibuddha is not mentioned, but where the concept is alluded to in other words are presented: First KCT V:49: rgvedal)1 pascimasyad api gadati yajur vamavaktraj jinendral; savyiisyat samavedal)1 paramaharikule 'tharval}al)1 purvavaktrat I purvasyat kaulatantral)1 punar aparamukhad garu¢al)1 bhatatantral)1 siddhantal)1 vamavaktrad udayar avinibhad vi~l}udharman ca savyat 1/ 49// 725

The f!.gveda is expressed from the western [face] and Yajur [veda] [is expressed] from the left mouth by Jinendra; From the right face [he elaborates] the Samaveda, in the clan of the supreme Hari (Vishnu), from the eastern mouth [is spoken] the Atharva-veda.

724See also for this verse Wayman. 1985:7-8 and Gr6nbold. 1992:12. Banerjee 1985:212 and Vimalaprabhii V.I in VP Vol.III. 1994:34. Tibetan: Bu-ston. 1965a:225, line 7 to p.226, line 2. 725

135

From the eastern face [he expresses] the kaulatantras, moreover from the western face [he expresses] the Giiruq,a- and Bhiita-tantras. From the left face [he declares] the [Saiva] Siddhanta, [and] the Vi~T;ludharma [that is] like unto the rising sun [he declares] from the left [face]. . Here it is written that the four Vedas come out of the mouth of jinendra (the king among jinas) jina - indra and there is a possibility that this concept corresponds to the concept of Adibuddha. In that case, this would be another sign of the omniscience of Adibuddha. Perhaps also a sign of the inclusiveness of the Kiilacakra, as it also includes the basic literature on Indian religion in the doctrine of the Adibuddha. It also means that Adibuddha even taught the Vedas. 726 The syncretism of these texts becomes very obvious in this verse. Vi$T;lu and Giirut!a are mentioned and especially Vi~7;lu is honoured. Unfortunately, there is no commentary in the Vimalaprabhii to this verse. There are only a few remarks by Bu-ston that do not give much assistance. 727 Finally, the first chapter of the laghutantra. KCT. 1m, 3_4th lines: digrak$apalas tanmadhye kiilacakro jinavarajanako 'nahato vajrakayaf} II 21 11 728

In the midst of the guardians of the five directions is Kii.lacakra, he who produces the foremost ofjinas, is indestructible (anahato) and vajrakiiya.729 Jinajanaka, the producer of the jinas, is also used for Adibuddha according to the commentary, as is also "indestructible" (aniihata), which is also used for Vajrasattva, and lastly, vajrakiiya is also used for Adibuddha in the commentary. So, here Kiilacakra is equalled to Adibuddha.

4.3. ADIBUDDHA IN THE BASIC KALACAKRA TEXTS - A CONCLUDING SURVEY. As a summary of the above chapter, the characteristics of the Adibuddha, Kiilacakra and Viivamata as they are found in the KCT and the Vimalaprabhii are presented. 4.3.0. Adibuddha in the Sri-Kiilacakra-niima-tantra-riija (KeT).

Interpreted as: - the text (Paramiidibuddha, mulatantra, tantrariija, tantrariijiidibuddha), KCT 1:149, IT: 56., V:252. - bhagaviin = Adibuddha, IT:92. - unique teacher; II:92. Compare with Vimalaprabhii 1.4 Vo!.I. 1986. Vimalaprabhii Vo!.III. 1994:34 and Bu-ston. 1965a:22S-26. A commentary to the Sth chapter oftbe KCT. ns BaneJjee. 1985:6. 729 Newman. 1987a:SI3-S14. 726

727

136

- not one who acts; II:92. - omniscient; II:92. - ruler over the three worlds; II:92. - Kalacakri; II:92. - he is not Cakri (Vi~I).u); II:92. - Brahma, Vi~lJu and Rudra have found refuge at his footlotus; II:92. - progenitor of the best ofjinas (jinavarajananam); II:92. - without qualities (nirgulJa); II:92. - without (mental) constructions (nirvikalpa); II:92. - master ofjinas (jinapati); V:243. - everything is said in front of the eyes of Adibuddha; V:243. - Srimat tantradibuddham; V:243. - old but young; V:256. [MafijusrI]. - [Maiijusri is] born by all the jinas although in the beginning Adibuddha; V:256. - attached to women but living in chastity; V:256. [All the following concerns Maiijusri as Adibuddha]. - compassionate: V:256. - kinsman of the world; V:256. - enemy of Yama; V:256. - radiant as the moon; V:256. - brilliant vajra; V:256. - killer of Mara; V:256. - liberated in this world but enters the world to cure it; V:256.

4.3.b. Adibuddha in the Vimalaprabhii (JIP). Interpreted as: - aspectless although possessing aspects; Vimalaprabha I.1.in VP voU:!; (nr.2-6 are in the same place). - unchanging bliss (a~arasukha). - progenitor of the Buddhas. - possessing the three bodies. - knowing the three times. - omniscient. -non-dual. - innate master ofjinas (sahajajinapatl); Vimalaprabha I.1 in VP vol.I:!; (nr.9-!5, the same place) . . - jiilinakiiya, dharmakiiya, sambhogakiiya and nirmliTJakiiya. - body of the day-maker sun (dinakaravapus). - the eye of spreading the lotus-petals (padmapatrayatak~af:z). - liberations. - body, speech, lnind, passion (kiiya-vlik-citta-ragais). - beyond origination and dissolution. - non-dual wisdom and method.

137

- pure yoga (suddhoyoga); Vimalaprabha 12 in VPvol.H986:12;(nr.17-18 in the same place.) - vajrayoga that consists of wisdom and method. - without partiality (niranvaya). - Cakravartin of the three realms (dhlitu). Vimalaprabha 12 in VP vo1.I:12. - perfect enlightenment in a single instant; Vimalaprabha 1.2 ill VP vol.!: 17;(nr.21-23 in the same place). - supreme (parama). - the one who fIrst (lidi) obtained buddhahood. - without beginning in time; Vimalaprabha 12 in VP vol.!: 18. - without termination; Vimalaprabha 12 in VP vol.I:18. - indivisible vajrayoga; Vimalaprabha 14 in VP vol.I:32. - endless Buddha; (the same place). - the absolute; Vimalaprabhii 15 in VP vol.I:42-43. - supreme unchanging (paramlik~ara) (the same place). Divinities who are equalled to Adibuddha are: Klilacakra, Vajrasattva, Vajradhara and Also the own-nature body (svlibhlivikakiiya).

A~obhya.

4.3.c. Kiilacakra in the Vimalaprabhii. Interpreted as: - emptiness (sanya) and compassion (karUl;zIi); Vimalaprabhii I.1 in VP voU: 1. - without origination and annihilation in the three existences.; (the same). - the single image of knowledge and objects of knowledge; (the same). - the Buddha sitting on the lion throne; Vimalaprabha I.l in VP vol.!: 1; (the same fornr. 512). - the pure vajrayoga. - a single reality having 16 aspects, due to the division of the Bodies. - beyond non-existence and existence. - the unity of knowledge and objects of knowledge. - meeting of the best of jinas (jinavarasamayam). - the true aim having 12 aspects due to the factors. - bodhicitta. - the thunderbolt abode of the jinas (jinakulisapada1]'l). - he has abandoned the absorption of lilt and kiili, and the letters hu1]'l, phat and so forth; Vimalaprabhii I.1 in VP vol.I:2. - the body born from the unchanging (from lidibuddha!); (the same). - Definition : "Time (kiila, dus) has the characteristic of supreme unchanging bliss. One whose body is generated as a wheel (cakra; 'khor-lo) of unobscured aggregates, elements, and so forth by means of that [bliss] is Klilacakra"; Vimalaprabhii 1.2 in VP vol.!: 17.

138

4.3.d. ViSvamiita ill the Vimalaprabhii.

Interpreted as: - the progenitor of all the Buddhas (janani saravabuddhanii1!l);Vimalaprabha I.l in VP vol.I:2. - abandoned origination and destruction; (the same). - one who possesses the conduct of Samantabhadra.;(the same).

4.4. CONCLUSIONS.

Consequently, what can we find out about Adibuddha from looking at parts of these two texts? In the Sri Kiilacakra (KCT) the most important characteristics should be: - he is not one who acts; - omniscient (sarvajiia). - progenitor of the best of jinas (jinavarajananam); - without qualities (nirgU/;za); - without mental constructions (nirvikalpa); - master of jinas (jinapati); - ruler over the three worlds. In the Vimalaprabha the characteristics mentioned above and the following: - unchanging bliss (akearasukha); - progenitor of the Buddhas (jinajanaka); - non-dual (advaya); - beginningless; - endless; - non-dual wisdom and method; - the one who fust obtained buddhahood; - without partiality (retinue) (niranvaya). It is possible to find a number of qualifications of the Adibuddha in these texts. It fits in quite well with the general Adibuddha-theories. Especially that he is bringing forth the jinas and that he is eternal. Consequently, one can perhaps say that Adibuddha is described under this name in the two texts. Still it is not possible to find anyone Adibuddha described concretely and depicted iconographically as in Nepal. What is described more concretely is aspect or emanations such as Kiilacakra, Ak!fobhya, Vi.§vamata, Vajrasattva and Vajradhara. In the Indo-tibetan iconography one can recognize an aspect of Adibuddha in that they all have their arms crossed over the chest with vajra and bell in their hands. Another possible conclusion is that the whole description is a way to describe the .§flnyata (the Void). Adibuddha can also be described as the Void, according to classical miidhyamika Buddhism. Another way of describing the concept of Adibuddha is that it is a designation of the concept of tathagatagarbha, the notion that there exists a permanent Buddha-seed in all beings and the important thing for man is to discover his own Buddha-seed (garbha). Ruegg has treated the subject and he states about the tathagatagarbha that it is "characterized as permanent (nitya), immutable (dhruva), blissful (sukha), and eternal (.§a.§vata), and sometimes we are even told that it is iitman.',730 These epithets correspond well with the ones given to the concept of the Adibuddha in the KCT and the VP. In the Mahiiparinirvii1;lasfltra the concept of tathiigata contains the idea of being permanent,

730

Ruegg. 1992:19.

139

blissful, empty, without marks and "very pure" (visuddha).7Jl These concepts are found as designations of the Adibuddha in the KCTNP. In his analYiiis of the tathiigatagarbha, Ruegg concludes that the concept is not identical with the brahrnanical titman, but that it is founded on a distinct theory which may neutralize and cancel both the iitmaviida and the aniitmaviida. Perhaps there is a common stock of experiences which are used by both Buddhists and Hindus.732 This idea about the tathiigatagarbha has recently been presented by Steams in his work on Dol-po-pa. 733 Dol-po-pa states that the Adibuddha is to be compared to "indestructible self-arisen gnosis", probably corresponding to acintya-sahaja-jfiiina in Sanskrit. 734 Despite these reservations, it is probable that there really is some idea of an Adibuddha in the KCT and VP texts. The problem is that it is almost impossible to find a systematic description of the idea. As shown later in this text, more possibilities for interpretation open up when looking at the theory of the four bodies (the fourth body sahajakaya or suddhakaya) and the whole complex of ideas around the concept of the "supreme unchanging", "the supreme unchanging gnosis" or "supreme unchanging bliss" (paramakeara). The concept of something unmanifested which manifests itself in some way in order to shape the world as we see it, is of course known in other branches of Indian philosophy. In the sii/!1khya philosophy there are some similarities. It is the discussion on the root-base (mula-pra!qti, pradhiina) which is interesting; how the unmanifested (avyakta) is becoming manifested (vyakta). 735

Ruegg. 1992:22; Ruegg. 1973:123-124. Ruegg. 1992:54-55. Stearns. 1999:238-239 notes 30-32. 104 Stearns. 1999: 118. 135 See for example Simonsson. 1955:39-48 and Larson. 1979:160-167. 731

732

733

140

5. THE FOUR BODIES OF THE BUDDHA IN THE KALACAKRA TANTRA AND THEIR RELATION TO THE ADIBUDDHA CONCEPT.

5.1. INTRODUCTION. EARLIER RESEARCH ON THE FOUR BODIES OF THE BUDDHA. The concept of "bodies" "kiiya" came to be known in Mahayana Buddhism. It is a much discussed concept and there are many different interpretations. In the following, I will discuss research being done in this field. In his Introduction to the SekoddeSarikii, Mario Carelli treats the svabhavikakiiya as equal to Sahajakiiya. He also notes that the text says that the four bodies can be possessed simultaneously by the practitioner. 736 G. Tucci writes about the four bodies in his Tibetan Painted Scrolls?37 He says that the svabhavikakiiya738 has been added to the three others to stress the fact that these three bodies should not be understood as of three different natures, but are one identical nature, partaking of one single essence. Tucci adds that there is a theory of three or four bodies, postulating a dharmakiiya or sahajakiiya beyond all possible determination. This has a connection with the development of the Adibuddha concept. Tucci names the fourth body sahajakiiya and the four bodies have a correspondance to the four joys (ananda), of which the highest is sahajananda (=mahasukha). In the human body the sahajakaya is placed in the u/Fl}i/Fa at the top of the head. Tucci also writes in his work, The Religions of Tibet, that, in the context of treating the consecrations in the Anuttarayoga-tantras, the fourth "investiture" consecration (dbang) is there to eliminate personal defilements, which are at the base of the other three defilements, corresponding to the three lower bodies. In the same way, the three lower bodies dissolve in the corresponding svabhavikakaya. This concept, that is, to purify from the defilements, is another indication of why the fourth body is called suddhakaya in the KCT. 739 Herbert Guenther notes in his book, The Royal Song of Saraha, that there are four bodies, with the fourth as svabhavikakaya, but he adds that there is also a fifth body, called Mahasukhakiiya. These two together are a sort of causal result of the lower three, the final

736 Sekoddesatlkii. 1941:15-19. 7J7Tucci Vol.i. 1949:234-236,243-244. 718 svabhavikakaya from svabhava + kaya , which translates asa "self-existent body". The spelling sva... with a long a is taken from the Vimalaprabha and the Abhisamayalarhkara, although Tucci and Snellgrove have sva with a short a. Tibetan ngo-bo nyid-kyi-sku. "'Tucci et Heissig. 1973:87-88.

141

state of real being. 740 Guenther's Tibetan source also says that the sViibhavikakiiya is merely a name, and it is not an entity that can be pointed at. 741 D.L.Snellgrove writes in his Indo-Tibetan Buddhism742 that in the earlier Mahayana phase there was a question about two bodies who are form-bodies or rilpakiiya (sambhogakiiya and nirmal}akiiya) and dharmakiiya. Asariga occasionally wrote about the three bodies as dharmakiiya or sviibhiivikakiiya (self-existent body) and the other two. At a later stage, the svabhavikakiiya is distinguished from the dharmakiiya and regarded as absolutely transcendent. But in Mahayana, it is clear that the theory remains with three bodies and the dharmakiiya is also referred to as sViibhavikakiiya. In the tantras the svabhavikakiiya is placed above the dharmakiiya and is also referred to as the innate body (sahajakiiya) and body of great bliss (mahasukhakiiya). GUnther Gronbold relates in his article, Zwei Adibuddha-Texte, on how the Tibetan commentators on the Kalacakra interpret the position of Adibuddha in the system of the three or four Buddha-bodies. First, he cites Taranatha (l6th cent.) who places "Adibuddha" over the three kiiyas. Then he continues with Zhu-chen Tshul-khrims rin-chen (18th cent.), who relates Adibuddha to the Dharmakiiya Vajradhara. Finally, he quotes Bu-ston (12901360) who praises the Adibuddha as svabhavikakiiya. 743 However, Gronbold does not in his article refer to the treatment of the four bodies and Adibuddha in the two basic Kalacakra texts (KCT and VP), so that is where the analysis will begin. John Makransky wrote a dissertation on the four bodies in Buddhism and later published a book with the results of his dissertation. 744 As the work by Makransky is the latest and the most comprehensive, his arguments will be treated at some length. Makransky's analysis of how the word kiiya (body) was etymologized by the Indian commentaries to the AbhisamayalalTlkiira (AA) and Indian Yogacara commentaries are first quoted: 1. kiiya = "body" in the sense of salTlcaya, a collection of components or an accumulation of parts; dharmakiiya =the collection (kiiya) of Buddha's excellent qualities (anasravadharma); in some pre-Mahayana texts and a few early Mahayana passages, it has also meant "collection (kiiya) ofthe Buddha's teachings (dharma)." 2. kiiya = "body" in the sense of asraya, substratum or basis; dharmakiiya = the substratum (kiiya) of excellent qualities (aniisravadharma) or the basis (kiiya) of sovereignty over all phenomena (sarvadharma). 3.kiiya = "body" in the sense of embodiment; e.g., dharmakiiya =that which embodies the real nature of things, the embodiment (kiiya) of the real nature of things (dharmatii) in knowledge. While rilpakiiya has been a term of reverence for the physical form in which a Buddha appears to others, dharmakiiya has often been a reverential term for a Buddha's own enlightened awareness. The rilpakiiyas are the forms through which Buddhahood communicates with beings, categorized as sambhogikakiiya (the glorious form through which a 74°Guenther. 1968:91, note 23. Guenther refers to an unpublished work by a Tibetan writer, Karma phrin-laspa. '"Guenther. 1968:44-45,78. He cites Karma phrin-las-pa, Do-hii skor-gsum, fol.81a-b and fol.52b. 742SneIJgrove Vol. 1. 1987:36-37,115-116,250-251. "3 Gronbold. 1992a. 744Makransky. 1990 and Makransky. 1997.

142

Buddha .shares the dharma with great bodhisattvas) and nairmiiJ,ikakiiya (the limitless variety of forms through which a Buddha communicates dharma to the limitless varieties of other beings). Makransky then defines the sViibhiivikakiiya as "the embodiment [of Buddhahood] in its essence, in its real nature".745 Makransky treats the controversy over dharmakiiya starting with chapter 8 of Abhisamayiilmpkiira (AA) where there is a place, also quoted in the Vimalaprabhii, that can be interpreted as treating the four bodies of the Buddha. The place quoted in the VP is actually from Abhisamayiilal!lkiira, chapter LI7 (although quoted by Newman 1987a:368 as AA LI8): sViibhiivikai:z sasiimbhogo nairmiiniko 'paras tathii dharmakiiyai:z sakiiritras calurdhii samudfritai:z 746 In its essence (sviibhiivika), with its enjoyment (sambhoga), and in its manifestation(s) (nairmaniko) as well, embodiment of dharma (dharmakiiya), with its activity, is proclaimed

as fourfold. 747 Makransky makes a convincing interpretation of this verse, and others, to the end that here is meant the doctrine of three bodies, where dharmakiiya is referring to Buddhahood in its totality, having three fimctional modes, sviibhiivika, sambhogika and nairmiilJika. There are then actually no more than three Buddha-bodies, if the texts are correctly understood. Makransky also quotes Mahiiyiinasutriilahkiira as proof that the doctrinal position of both Miidhyamika and Yogiiciira Buddhism are that there are three bodies of the Buddha, not four.748 The interpretation that there are four separated bodies came from Haribhadra, who wrote a commentary to the AA in the late eighth century. Haribhadra interpreted the above cited verse as follows: The essence (sviibhiivika) [body], with the enjoyment [body], the manifestation [body], and the body of dharmas (dharmakiiya) with its activity as well: as fourfold are [they] proclaimed. 749 According to this interpretation there are four bodies, with the sViibhiivikakiiya as the fourth. This is clearly the tradition that was in vigour in the setting of the Kiilacakra Tantra, because in this tantra the bodies ofthe Buddha are clearly interpreted as four, although Bu-ston in his commentaries to the KCT and the VP tries to interpret these places as representing the three-body theory following the Sa-skya-pa tradition in Tibet. 750 I will also quote the AA 8.1, which together with the following, has been a source of interpretative controversy among Indian and Tibetan commentators: sarviikiiriil!! visuddhil!! ye dharmiii:z priiptii niriisraviii:z Makransky. 1997:5-6. As quoted in Makransky. 1997:164. 747 Translation by Makransky. 1997:164. 748 Makransky. 1997:164-67. 7'9 Haribhadra. 1932-35:914. 750 See Newman. 1987a:368-69. 745

746

143

sviibhiiviko muneJ:! kiiyas te~iiJ'!'l prakrti-lak~mJaJ:!?51

The embodiment of the Sage (mum) in his essence (sviibhiivikakiiya): Its identity is the primordial nature (prakrn) of the undefiled dharmas which are obtained in utter purity. Makransky continues his analysis of the concept of sViibhiivikakiiya which is here defined as the primordial nature of the undefiled Buddha dharmas. The list of the dharmas is then presented in verses 8.2 - 8.6. and at the end comes the constatation that iti dharmakiiyo abhidhiyate, "thus the dharmakiiya is denominated." This would then define the sviibhiivikakiiya as another way of naming the dharmakiiya. 752 Historically, there were two traditions for interpretation of the AA in this context. The first is to interpret the texts (AA I.17 and 8.1-6) as that there really exists no more than three bodies of the Buddha. The interpretation of these bodies can differ in various traditions, but if a fourth body (sviibhiivikakiiya) is mentioned it is only another name for dharmakiiya, or is a sort of collective denomination of the three together. The other line of interpretation is that there exists four bodies of the Buddha and the fourth is the sViibhiivikakiiya (essence body). In Yogiiciira texts the sviibhiivikakiiya was described as unconditioned and had connections with the Tathiigatagarbha. I have found no mentioning of the fourth body as suddhakiiya or sahqjakiiya, as in the Kiilacakra, in the material of Makransky on the AA texts. Consequently, the treatment of the concept of the four bodies is quite different in a late tantric text like the Kiilacakra Tantra compared to earlier Mahiiyiina texts. The conclusion from the work of Makransky is that the main tradition of the IndoTibetan Buddhism has a tradition of three bodies of the Buddha, but that there exists another tradition which counts on four bodies. This tradition of four bodies is present in the Vimalaprabhii, including quotations from the AbhisamayiilaJ'!'lkiira. Paul Harrison has written an interesting article on the Dharmakiiya.753 Vesna A. Wallace has written the most recent contribution to the discussion on the four bodies in the Kiilacakra Tantra. 754 In a chapter of her dissertation from 1995, she claims that Buddha's four bodies are indestructible and supreme manifestations of the Paramiidihuddha. She also remarks that the Paramiidibuddha was the one who first attained enlightenment by means of the unchanging bliss (ak~arasukha), as is stated in the introductory part of the VP (see p.l04 of this work).755 She also writes that the four bodies of the Buddha can be interpreted as the four different manifestations of vajrayoga. The sahajakiiya is identified as the visuddhayoga (purified yoga) consisting of wisdom and method and which is a single union of visuddha and jfiiina. She notes that sometimes the fourth body is named sViibhiivikakiiya (nature body) and that this refers to the body of the prajfiiipiiramitii and, in consequence, with the indestructible Adibuddha, identified with the Bhagaviin Kiilacakra. 756 She holds that, in order to attain the unchanging bliss and the Haribhadra. 1932-35:914. Makransky. 1997:170-71. 753 Harrisson. 1992. 754 Wallace. 1995:103-125 and Wallace. 2001:143-170. 75S Wallace. 1995:103-104. 756 Wallace. 1995:109 and VP Vo1.I. 1986:42-43. 751

7S2

144

body of the Buddha and the jfiiina, it is necessary to hold the view of the Miidhyamikas and have the right insight into the nature of emptiness (Sunyatii). I would not be so categoric in the necessity of holding this view, as it seems possible to be adhere to the Kiilacakra being, for example, an adherent to the "substantialistic" gzhan-stong theory as does Dol-po-pa. The second work of Wallace has reached me at a late stage in my work, but I will comment on some of her theories. She attempts to demonstrate that the Kiilacakra tradition in India is an authentic gnostic tradition of Indian Buddhism and that gnosticism manifested itself in a great variety of forms. Following John Newman, she translatedjfiiina as "gnosis". She also used the definition of gnosticism formulated by Hans Jonas that the emphasis is on gnosis as the means for attaining liberation, or as the form of liberation itself and the claim to the possession of gnosis. 757 She applied this definition to the Kiilacakra Tantra and also to other anuttara-yoga-tantras. I think that her arguments for comparing the Kiilacakra Tantra to gnosticism are good. There is a stress on knowledge Ofiiina) which is very important in the texts. The concept of the supreme unchanging knowledge (paramiikeara-jfiiina) is of great importance, as will be shown in the following chapter. Concerning the theory of the four bodies of the Buddha, Wallace describes the sixteen aspects of the four bodies and names the fourth body sahajakiiya. She also describes the location of the four bodies of the Buddha in the human body in a similar way as to how they are described below. 758

5.2. THE FOURTH BODY OF THE BUDDHA IN THE KALACAKRA TEXTS.

5.2.1. The four bodies in the introductory parts of the Vima\aprabha. As early as in the introductory part of the text Vimalaprabhii, the four bodies are mentioned. The four bodies, with sahajakiiya as the highest, are treated in the text below. On the same page it is given as a fact that: sarvajfiarr jfiiinakiiyiikhyarr martta!J4avapuearr vibhum I padmapatriiyatiikearr tarr tatlvarr eotjasabhedata!J II catu!Jkiiyiitmakarr buddharr vajrasirrhiisane sthitam 1 759

Homage to the omniscient one, the one calledjfiiinakaya, the body like the sun, lord, the eye of the spreading lotus petals. He [the omniscient one, Adibuddha] is the Buddha consisting ofthe four bodies due to the division of the sixteen realities. He sits on the vajra lion throne. 76o Wallace. 2001:144 and Jonas. 1963. Wallace. 2001:156-159. 7S9 Vimalaprabha Vol.I. 1986:2, line 23-25. 760 Translated in Newman. 1987a:225. The sixteen aspects of reality are explained in Vimalaprabha Vol.l. 1986:45 (transl. in Newman. 1987a:376-377). They are the four joys (iinanda) connected in different ways with the jfiiina, mind, speech and body. All these aspects are called Sahajakiiya, which is the highest among the four bodies, It is also explained in Vimalaprabhii VoU (Newman. 1987a:236) where they are quite different from the explanation above. 7S7

758

145

In the following text of the Vimalaprabhii is found, a commentary on KCT 1:1, the actual expression sViibhiivikakiiya for the first time in the context of when the Adibuddha is ' equalled to sviibhiivikakiiya. 761 A very interesting connection with the Mahiiyiina-text AbhisamayiilaTflkiira I: 18 is then made at the same page of the Vimalaprabhii.

sViibhiivikaIJ sasambhogo nairmiil')iko 'paras tathii / dharmakiiyaIJ sakiiritraJ; caturdhii samudfritaJ; /1'67. The sviibhavika[kaya] together with the sambhoga[kaya] likewise the nirmiil')a[kaya] [are] the dharmakiiya. Together with activity (kiiritra) it is rightly said to be fourfold. 763 Then follows:

sa eva bhagaviin mantranaye phalalak~al')e sahajiinandaIJ sahajakaya ity ukto 76. This very Bhagaviin is called sahajiinanda and sahajakaya in the mantra system that is characterized as the effect.

Haribhadra 765 writes that these informations about the dharmakiiya are fourfold, sViibhiivikakiiya, etc." This first (and highest) body is characterized by "purity". Perhaps one of the reasons why it is later in the KCT called "the pure body" (suddhakiiya). The body has the nature of svabhiiva before it has arisen. This svabhiiva is not created (absolute), consequently the sViibhiivikakiiya is a way of saying non-created, absolute and pure.'66 All things (dharmas) in their pure (visuddha) form are sviibhiivikakiiya. Buddha has such a body that can be realized by others. Then Haribhadra comments directly on the verse that is cited in the Vimalaprabhii and says that it actually means that there are only three bodies, but that it is contradicted in other places. For example, in AbhisamayiilaTflkiira 8: 1 the fourth body is clearly distinguished and the marks of its essential nature are actually the other three bodies dharma, sambhoga and nirmiil'Ja.767 As a conclusion, it can be said that Haribhadra already gives some of the most essential characteristics of sViibhiivikakiiya and the Adibuddha as these concepts are used in the Kiilacakra literature. Coming back to the Vimalaprabhii, on the following page the

761 762

Vimalaprabha Vol.!. 1986:43; Newman. 1987a:368. Sanskrit text of AA. 1:18 in Vimalaprabhii 1.5 in VP Vo!.!. 1986:43, line 5-6, where it is written susamb-

hogo and not sasambhogo which is more correct. 763 Vimalaprabhii Vol.!. 1986:43; Newman. 1987a:368 and note 4 where Newman remarks that Bu-stonin hts commentary supports the three-kaya-theorybut Haribhadra. 1932-35:914-916 interprets this verse as teaching four kayas. See also the dissertation by John Makransky on the four bodies in Buddhism (Makran sky. 1990 and 1997). 764 Vimalaprabha Vol.!. 1986:43, line 8. 765 Dated to the late 8 ili century (Nakamura. 1987:283 note 88 and Makransky. 1997:7). 7" Haribhadra. 1932-35:914. 767 Conze. 1954:96 and Haribhadra. 1932-35:914.

146

Bhagaviln (Adibuddha) is equalled to sahajakiiya, it has abandoned object and subject and it is not localized in existence or nirvilIJa,768 Consequently, in these pages there is another connection between Adibudda, sVilbhilvikakiiya and sahajakiiya, Later on in the text there is again a mention of sahajakiiya as the supreme body, In the long introductory commentary on KCT I: 1: (pAS: 13) ,oq,asiikilraf!l taltvam iii sa eva sahajakiiya~ Hinyatiivimok,avisuddho jfiiinavajra~ visuddhayoga 769 / sa eva dharmakayo 'nimittavimok,avisuddha~ cillavajraf!ljfiiinakiiya~ prajfiopiiyiilmako dharmayoga ity ukta~ / sa eva sambhogakiiya~ apraIJihitavimok"avi§uddha~ viigvajraf!l dinakaravapu~ prajfiopiiyiilmako manlrayoga ity ukta~ / sa eva nirmiiIJakiiyo 'nabhisaf!lSkiiravimok,avisuddhaf!l kiiyavajraf!l padmapalriiyaliik,a~ prajfiopiiyiilmaka~ saf!lSlhilnayoga ity ukla~ / evam etaf!l vajrayogaf!l calurvidhaf!l buddhaf!l PTccheda vajrapiiIJir iii / siinyaliivimok"avi§uddho jfiiinavajra~ prajfiopilyiilmaka~ sahajakiiya~ sarvajfiatiipriipla~ sarvajfia~ sarvadarsitviil / (pA5:20) aniinittavimok"avi§uddha~ cittavajra~ prajfiopilyiltmako dharmakiiya~ milrgilkiirajiialiiprilpto jiiilnakiiya~ paramilk~arasukhenilvasthitatvilt (pA5 :21) /770 sarvajfia~ prajfiopiiyiitmako

(pA5: 13) As for the essence of the sixteen aspects, [it is] the sahajakiiya purified by the emptiness liberation,77I jfiiinavajra, the omniscient one, the one that consists of wisdom and method, the pure yoga, Just that Dharmakiiya is called, purified by the signless liberation, the mind-vajra, the jfiiinakiiya, the one that consists of wisdom and method and the dharmayoga, That very Sambhogakiiya (enjoyment body) is called, purified by the wishless liberation, the viigvajra (speech vajra), the body ofthe day-maker sun, the one that consists of wisdom and method and the manlra yoga, That very NirmiiIJakiiya (transfonnation body) is called, purified by the non-constructed liberation, the kiiyavajra, the eye like spreading lotus petals, the one that consists of wisdom and method and the saf!lSthiinayoga (the shape yoga), VajrapiiIJi asked the Buddha for such a four-foldyoga,(pAS:20) As for the one purified by the emptiness liberation, the jfiiinavajra, the Sahajakiiya that consists of wisdom and method and the one that has obtained omniscience; because it sees everything it is the omniscient one, As for the one purified by the signless liberation, the cittavajra (mind-vajra), the Dharmakiiya that consists of wisdom and method, the one that has obtained knowledge of the aspects of the path, It is the jfiiinakiiya because it abides by means ofthe bliss of the supreme unchanging (paramiik"arasukha) (pA5:21),

VimaIaprabhii VoLL 1986:43; Newman, 1987a:369, VimaIaprabhii 1,5 in VP VoLL 1986:45, line 13, 7" VimaIaprabhii 1,5 in VP VoLL 1986:45, line 13-21, Translated in Newman, 1987a:378-79, 771 The four liberations are mentioned, 1 fanya/a vimok"a (emptiness liberation), 2 animitta vimok"a (signIess liberation), 3 Apmnihita vimok"a (wishIess liberation), 4 An-abhi-sarrzskara-vimok,a (nonconstructional liberation). In the PilIi canon only three vimok.Jas are mentioned. The fourth here corresponds to the fourth body concept introduced later, In this context there are also mentioned the four yogas: 1 visuddha-yoga (purity), 2 dharma-yoga, 3 mantra-yoga, 4 sarrzsthiina-yoga (configuration yoga), They also correspond to the four bodies beginning with sahajakiiya, 768

769

147

This is part of a brief explanation of the vajrayoga which actually is an explanation of that which has gone beyond existence and non-existence and is non-dual. 772 One can again see the similarities with the characteristics given to Adibuddha in the ' Ktilacakra texts. In connection with this, the svtibhtivikakiiya is defined as "the omniscient one," dharmakiiya as "jiitinakiiya," sambhogakiiya as "the body of the day-maker sun," nirmtilJakiiya as "having eyes like spreading lotus petals." Here we have once more the identification of "the omniscient one" with svtibhtivikakiiya and the above also shows that sahajakiiya is equalled to sarvajiiti, which means that it is equalled to sViibhiivikakiiya and in consequence with Adibuddha. 773

5.2.2. The fourth body as suddhakiiya (the pure body) and sviibhiivikakiiya (the selfexistant body) in the Kiilacakra texts.

In various places in the texts of the Kiilacakra Tantra 774 it is expressed that in this context one can see the concept of Adibuddha as equal to the concept of a fourth body of the Buddha, the svtibhiivikakiiya (tib. ngo-bo nyid-kyi-sku), also called sahajakiiya (tib. lhan-cig skyes-pa'i sku), suddhakiiya (tib. dag-pa'i sku) and sa1!lsuddhaktiya in the laghutantra and the Vimalaprabhti. I am now going to show how this is done in these two texts. In the Sri Ktilacakra-tantra-riija (KCT) we can find the concept of the fourth body mentioned as suddhaktiya or sahajakiiya, while I have not found a mention of it as sViibhiivikaktiya. The second chapter of KCT, the Adhyiitmapata1a, treats the human body as a microcosmos of the description of the outer world (the macrocosmos). In the first chapter, Lokadhtitupata1a, there is found an interesting description of the four bodies. Here follows a quotation from KCT IT: 14: garbhe sa1!JsuddhaktiyaJ:t prasavanasamaytid dantabhtivo 'rtha dharmaJ:t danttinti1!l vai praptitaJ:t prabhavati nrpa sambhogaktiya jinasya ! tasman nirmtil}aktiyaJ:t prakaritaniyato mrtyusfmno nartil}ti1!l garbhe biihye caturdhti bhavati punar asau jiltinavijiliinabhediil !!14!! 775

Oh King, in the womb the suddhaktiya [the pure body], until the birth, when the dharma [kaya] emerges [and stays there] until the time when the teeth emerges [at about six months]. The sambhogaktiya ofthejina emerges [and stays there] until the time of the falling of the teeth [at the age of 6-7]. After that, the nirmiil}akiiya is fixed and made evident until the time of death. In the matrix, and outside, emerges the fourfold [the four ktiyas], departing from the division into jiltina and vijiliina.

VimalaprabM 1.5 in VP VaLl. 1986:43. line 28-29. Translated in Newman. 1987a:372. See also Newman. 200 I :589-90 for a discussion of the concept of vqjrayoga, which by Newman is seen as a concept similar to AdibuddhalKalacakralVajrasattva. 773 VimalaprabM 1.5 in VP Vol.I. 1986:45, line 30- p.46, line 1. Newman. 1987a:380. 77'See the chapter below on "Adibuddha in the Kalacakra" for information on the Ktilacakra texts. 715 KCT II:14 Banerjee. 1985:47; Vimalaprabha II. I in VP VoI.!. 1986:163, line 16. 772

148

Here the word suddhakiiya is used for the kind of consciousness which emerges at the moment when an embryo has been brought into existence. Then it stays in the womb until the child is born. From the time of birth until about six months, dhannakiiya is prevalent in the child. From six months up to 6/7 years of age, sambhogakiiya reigns and for the rest of the life it is ninnti7;lakiiya. All this must be a way of comparing the microcosmos of the human body to the concepts of the four bodies of the Buddhas. The first one, the suddhakiiya, is hidden and the other three are more or less visible. Consequently, suddhakiiya can signify the unmanifested, Adibuddha. In the following two verses KCT 15-16, suddhakiiya refers to the foUrth body:

vijFianaTft candrasilryav api kamalagataf.t suddhakiiyaf.t sa garbhe dhatuskandhodbhavo yo bhavati dasavidho dharmakiiyo jinasya I tasmat sambhogakiiyo bhavati gu1)avasac chotrasabdiidijate tasmat keiadijate prasavanasamayas calra nirmalJakiiyaf.t1115// 776 [When the three] vijiiana (vp: alayavijiiana), moon (vp: the male seed) and the sun (VP: the female menstruation blood) have come together, in the womb [there is] suddhakiiya. Then when the elements and the skandhas have emerged, the 10-fold dharmakiiya of the jinas emerges. Then the sambhogakiiya emerges when the ears and the sound have been born under the influence of the gu1)as. After that, when the hair has emerged, [at] the time of birth [emerges] nirm(1)akiiya. The commentaries are from the Vimalaprabha. It can also be said that the moon is the left channel, lalanti, the male and uptiya (method); tilayavijfitina 777 stands for the middle channel, avadhati, the sun stands for the right channel, rasanti, the female and prajiiti (wisdom). When these three channels meet, mahtisukha (the great bliss) occurs. 778 The subject of when the four bodies emerge from conception up to birth is treated. The highest body, suddhakiiya, emerges in the matrix, and then, in sequence, the other three. The last one, nirmti7;lakiiya, emerges at the very moment of birth. Consequently, this verse draws the microcosmic resemblance one step fUrther. The fact of how the four bodies can be said to exist within the womb is treated. The suddhakiiya is said to come into existence at the moment of conception. It is the first level of existence. Comparison to what can be found on the four bodies in the fifth chapter is evident. There the fourth body is the first level of existence and not completely identified with the Adibuddha. The following level of existence is the lO-fold dharmakiiya of the fivejinas. Probably here are counted the female consorts of the five jinas: VairocanalVajrasattva, Alqobhya, Amittibha, Ratnasambhtiva andAmoghasiddhi. It may also be the ten saktis or nimitta. Here follows the KCT 11: 16:

jate sViisodbhavo yaf.t prabhavati nirgu1)af.t suddhakayaf.t sa eva tasmat dantodbhavo yo 'sphufam api vacanaTft dharmakiiyas tathaiva I 77'KCTII:15; BaneJjee.1985:47;VimalaprabhiiII.I in VP Vol.I. 1986:163. line 17. 177Comparing this concept to the concept of iilayavijiiiina in the Yogaciirii school, it is an entirely different concept. 778T!lis is stated in other places in the text. Also, generally in the higher tantras. See Dasgupta. 1974 (1950).

149

lasmiil piilo dvijiinii,!, prabhavati nrpa sambhogakiiyo jinasya dantebhyal;z mrtyuslmne bhavati jinapater biihyanirmiil}akiiyal;z 11161/ 779

[When in the outer the four bodies] are born, (first) when one begins to breathe, suddhakiiya which is without characteristics, (emerges in the middle channel [avadhiitiJ). Thereafter dharmakiiya [exists until] the emergence of the teeth, that is, that which is unclear speech. After that comes the fall of the teeth, oh King, and that is the sambhogakiiya of the jina. After [the loss of] teeth until death, the nirmiil}akiiya ofthejinapati (the master ofjinas) emerges in the outer. The wording "Oh King" shows the context, that here Buddha Stikyamuni is explaining the Kalaeakra to king Sueandra. This verse is a continuation of the fore-going one, it is explained in the outer how the four bodies are related. Here the four bodies in relation to the inner body of the human being already born are treated. The suddhakiiya emerges at the time when the breathing emerges, and it is without characteristics. According to the Vimalaprabhii, the suddhakiiya is placed in the middle channel (avadhati) and is without characteristics, which corresponds well with the the characteristics of the Adibuddha. This sort of inner dharmakiiya emerges when the teeth are emerging in the child. The sambhogakiiya emerges when the milk-teeth are falling, and the nirmtil}akiiya is then there for the rest of the life. Jinapati here possibly corresponds to Adibuddha, and in that case, the nirmiil}akiiya is the outer manifestation of the Adibuddha. In many other places in the KCT, jinapati stands for Adibuddha. These three verses give different interpretations of how to find correspondence to the four bodies and the human body. The four bodies can be characterized as follows from these verses: Suddhakiiya - the transcendent level, without characteristics, the unmanifested level Dharmakiiya - in some ways the fIrst manifested level of existence Sambhogakiiya - associated with sound and hearing, the sound and speech level Nirmtil}akiiya - more the physical existence, the normal body.

I will return later to comparing these concepts with others related to the Adibuddha concept. The following verse KCT II: 17 also has connotations with suddhakiiya: garbhe srzkiiyavajrm!/ prathamam iha bhaved vtilcsvarupa/fl prasate cilia,!, dantodbhave vai punar api pataniid udbhave jfiiinavajram I jfiiina'!' vijfiiinamisra,!, ravisasisahita'!'jiiiinavajriidi sarva,!, garbhe rii¢ha,!, kramena prabhavati ba/avat kiiyavajriidinii ea 11171!,80

First, in the matrix, the sri kiiyavajra emerges, then the viiksvariipa is born (is, according to VP: Vllgvajra, that is, the emergence of priil}a). Then, when the first teeth have fallen, the cilia [-vajra] emerges. Thejiiiinavajra 779 780

KCT 11:16; Banetjee, 1985:47; Vima1aprabha ILl in VP Vol.L 1986:164, line 1-4. KCT 1I:l? Banerjee. 1985:48; Vima1aprabhii 1.1 in VP Vol.L 1986:164, line 28-31.

150

emerges when the new teeth have grown out. Then the jFii'ina is mixed with vijFii'ina (VP: i'ilayavijFii'ina), and gets provided with the moon and the sun. ThejFii'inavajra, etc, everything, grown up in the womb, it [thejFii'inavajraJ emerges succesively. It becomes like a child because of the kiiyavajra, etc. Jfiiina and vijfiiina are in the Vimalaprabhii compared to sahajiinanda781 which is the highest of the four joys. Viigvajra (word-vajra) equals dharmakiiya, cittavajra (mind-vajra) is the same as sambhogakiiya. In this verse, the series of concepts kiiya (body) - viik (speech) - cilta (mind) - jniina (wisdom) is treated. Srfkiiyavajra ("body"-vajra) is here clearly to be associated with the concept of suddhakiiya, as they both come first in the line of concepts including also jfiiinavajra. The other correspondences and jfiiinavajra (knowledgevajra) are the same as nirmiilJakiiya. This is not very clear, as one would expect the knowledge-vajra to correspond to suddhakiiya and not to the "body"_vajra. 782 These four verses with their commentaries are different ways of indicating the correspondances between the microcosmos, the human body in the womb and after the birth, and the macrocosmos with the emergence of the whole universe as it is treated in chapter five. From these quotations, one can see that suddhakiiya corresponds to the fourth and highest body, which has characteristics similar to the Adibuddha concept. It is the first to emerge in the matrix and also, as in verse II:16, it is the first functionally (the breathing). As we shall see later it is also found in the Vimalaprabhii. The verses following after these treat the emergence of the elements and the five skandhas in the human body at the microcosmic level. The same subject is treated on a macrocosmic level in chapter V:89 and following verses, with the emergence of the universe. I will return later to this subject. The following verse treats the suddhakiiya in the fourth chapter of the KCT and VP, KCT IV:95: idiinf'!' ca/lIhkiiyaparisliddhir ucya/e: divyi'i bllddhi'is ca vidyi'ih satarusakalaSii suddhakiiyo jinasya krodhendri'i bodhisa/tviih khalll rasakliliSii dharmakiiya/:z sa eva /195// 783 Here is described the complete purification of the four bodies: The suddhakiiya ofthe jina that consists of parts [is] divine knowledgeable Buddhas. Even the dharmakiiya is really the master of krodhas, the bodhisattvas and the six "diamonds" (rasakuliSa). Rasa means "six" and there are six of something which could be six va/ras or possibly the sixjinas or the lord of the six clans. Six is an important number in the Ki'ilacakra and there are also six cakras. Next, from the Vimalaprabhi'i commentary to this verse: suddhakiiyo jinasya malJ¢ali'idhipate/:z / tate hi'ihyapu!e cittama1J¢aladvi'ire~lI krodhendri'i vighni'intaka/:z prajFiiintaka/:z padmi'intaka/:z yami'intaka/:z UelJ fea/:z /784 For a thorough evaluation oflhesahaja concept, see Kvaeme. 1975:109-110. According to a communication from Newman (June -04) the usual correspondances arejFianasuddhakaya; citta-dharmakaya; vak-sambhogakaya; kaya-nirmalJakaya '" KCT IV:95, line3-4. Baneryee. 1985:164; Vimalaprabhii IV.3 in VP VoU!. 1994:194, line 17- 19. 781

782

151

The suddhakiiya of the jina is the master of the mandala. Therefore, in the outer section, in the rnind-ma~ala [is] Krodhendr~ '(the master of krodhas), famantaka, u,(lf,a (the crown cakra), Vighnantaka, Prajfiantaka, Padmiintaka, [antaka means: the end, limit, one who prepares the end or death]. This verse is in the subchapter that treats the purification of the four bodies of the Buddha. 785 It can be remarked here that the Suddhakiiya of the Jina is the masterlLordlruler of the ma(lifala, that is, Kiilacakral/i.dibuddha. I will now quote another. verse in the same sub-subchapter, KCT N:97:

siistii divyadikumbhiil;! sahajajinatanur ma~ale garbhamadhye buddhiidya dharmakiiyal;! khalu rasakulisiidyiiS ca saTflbhogakiiyal;!1 krodhii786 nirma(lakiiyo bhavati kulavasiin ma~ale garbhasaTflkhyal;! camu(lifadyaeradevyal;! parijanasahital;! suddhakiiyo hi bahye 119711 7• 7 Beginning from the divine ruler and the vases; in the middle of the core (garbha) of the ma(lq.ala, [there is] the body of the innatejina (sahajajinatanu); beginning from the Buddha [there is] indeed the dharmakiiya; and beginning with the rasakulisa (thunderbolt) [there is] the sambhogakiiya. The krodha is the nirmiiT,lakiiya. fu the ma~ala is the order according to the family calculated after the core (garbha) [ofthe maT,lq.ala]. Because beginning from CiimUT,lq.a the eight deities accompanied by their retinue are the sUddhakiiya in the outer. This is a way of arranging the deities in the maTJifala. The context is the same as in the foregoing passage and it can be interpreted that the sahajakiiya is the centre and the beginning of the maTJifala. Suddhakiiya is mentioned as being connected with CiimuTJr.ja, the spouse of Siva. The concept of suddhakiiya is also found in KCT V:124 where it is again mentioned as the highest among the four bodies. I begin by translating the previous verse, KCT V: 123, in order to understand thecontext:'88

idanfTfl catu,kiiyaniiTfl ,oq.asaprabhedii ucyante _ kiimii nirmiiT,lakiiyaiJ, prabhavati niyatas tasya vageva purTJii jViila nirmaT,lacittaTfl paramasukhakaraTfl jfiiinam eviisya coq.rii'" 1 iinando bhogakiiyal;! sa paramaviramiinandam asya kramena viikcittaTfl jfiiinavajrOTfl bhavati hi sahajiinandam eviisya sambhoI;!II123/!'· 784Vimalaprabha IV.3 in VP VoI.lI. 1994:195, line 3-4.

7" VimaJaprabha IV.3 in VP VoI.lI. 1994:194, line 17 to 198, line 26. , 786 In accordance with the structure of the tex~ I here follow Banerjee's edition who has krodhii instead of krodha. 787 KCT IV:97. BaneJjee. 1985:165; Vimalaprabhii IV.3 in VP VoI.lI. 1994:195, line 17-20. 788 Concerning this and all the translations from chapter 5 of the Vimalaprabhii, I initially worked with the Tibetan translation and later made a correction of the translation from the Sanskrit. When I started working with these texts the Sanskrit edition did not yet exist. 78' ca _ ur/.ra. This could be the name of the region of Orissa?

152

Here the division into sixteen parts of the four bodies is stated: Passion (kama) is the nirmalJakaya, restrained it is its very speech. Fire is the mind oftransfonnation (nirmalJacitta) creating supreme bliss, the knowledge of these is the w;lra [the Orissans]. Joy (ananda) is the [sam]bhogakaya, it [becomes] gradually the supreme joy (paramananda) and the joy of cessation (viramananda). Speech and mind (citta) become the knowledge (jiiana)-vajra, because [it is] the very simultaneously-arisenjoy (sahajananda) of this Sambhu (lord). 791 Kama, purlJa, jvala and uq,ra are technical term for states of sexual excitement. There are sixteen terms altogether. Here the nirmalJakaya is treated and the subject of the four joys tinanda, paramananda, viramananda and sahajananda is commented upon. They are connected with the four bodies. K vrerne translates these terms as joy, perfect joy, joy of cessation and simultaneously-arisen joy.792 What is then the meaning of the term Sambhu? It is not evident from the context, but it could be a way of designating the superior entity in this tantra, the concept of Adibuddha. Next follows the verse KCT V: 124: kampa vai dharmakayas tribhuvananimitas tasya vagudbhaval; syad ghiirma vai dharmacillal!' bhavabhayamathanal!' jiianam asyaiva nidra 1 varr;o vai suddhakayal; svararahitakala bindunadal; kramena vakcittQ1!l jiianavajral!' trividhabhavagatal!' suddhakayasya sambhol; 111241/ 793

The tremblings are the dharmakaya, honored by the three worlds; by it there occurs the origination of speech. The gharmas indeed, are the dharma-mind (citta), the knowledge which destroys the fear of existence, from this indeed, is sleep. The syllable, indeed, is the suddhakaya, the bindu-sounds of the parts that are gradually [becoming] without sound. Speech and mind (cilia) [become] the knowledge (jiiana)-vajra, located in the three-fold world, from the suddhakaya of the Sambhu. These two verses are part of the subchapter where the four bodies of the Buddha are treated (KCT V:89-126). The four ktiyas each have body, speech, mind andjfitina and therefore there are sixteen. Here, Sambhu might represent more explicitly the Adibuddha as it stands for "the Lord" and is used as a name for Brahma, Vi~lJu and Siva in other contexts. It means "benevolent, causing happiness.,,794 In the fore-going verse it is also stated that Sambhu possesses the quality of the simultaneously-arisen joy, sahajtinanda, also a qualification which can be asigned to the Adibuddha concept. Sambhu also has a purified body, which, in other contexts, is used as corresponding to the sahajaktiya. Consequently, a possibility is that here there is suddhaktiya (the purified body) as the body of Adibuddha. Finally, there is one more quotation in this context. KCT V: 193-194 with the VP KCT V:123; Baneryee. 1985:230; Vimalaprabhii V.2 in VP Vol.III. 1994:58, line 3. Tibetan: Bu-ston. 1965c:98, line 2-7. 791"beneficient, kind etc." Also a name for several gods like Siva, Brahma and Vintu. (Monier-Williams) 792 Kvreme 1975:109-110. 793 KCT V:124 Baneryee. 1985:230; Vimalaprabhii V.2 in VP Vol.IlI. 1994:58, line 17. Tibetan in Bu-ston. 1965c:98, line 7 - p.99, line 6. 794 See Monier-Williams. 1976 (1899):1055. 790

153

commentary: idiinil!' buddhanirmiilJam ucyate _ . eteeiilT' muktihetoiJ sasutajinapatiiJ karmabhamyiil!' pravisya garbhiidhiinal!' hi krlVii paramakarulJayti bodhim utptidayiIVii 1 mtiraklesiin niptitya keititalanilaye dharmacakral!' pravartya krlVii nirmiilJamiiyiil!' punar api bhagaviin suddhakiiyaiJ sa eva 11193// 795

Here is desribed the transformation [body] (nirmtilJa) of the Buddha. For the sake of liberation of these [living beings], the master ofjinas with sons; after having entered into the karma-world; after having descended into the womb; after having produced the bodhi (awakening) by the highest compassion; after having defeated the defilements of Miirii; after having started to tum the wheel of dharma on the surface of the earth and after having made the illusion of supernatural creation, again, this Bhagaviin is just this Suddhakiiya. Here is stated that the Bhagaviin (who Bu-ston later identifies with Buddha Siikyamuni) is identified with the suddhakiiya. It is also said that the jinapati with sons, which ought to be interpreted as the Adibuddha with the jinas, is more or less descending on earth in order to liberate the beings. This is not in harmony with how the Adibuddha is described in other parts of this text. Could it be interpreted that the Siikyamuni Buddha is equalled to the Adibuddha? In the VP very little is written on this verse, only that the Bhagaviin possessing a suddhakiiya is a Tathiigata. 796 The Pure body (suddhakiiya) consequently is a measure of the state of purity of a Buddha who then is considered a Tathiigata. One can suppose that the Buddha had attained a purified body after having awakened to liberation from the limitations. Bu-ston has nothing to add in his commentary. KCT V: 194 follows: tasmtij jtito na naetas tribhavam api gataiJ suddhakiiyo jinasya satIViirthal!' sarvadii na tyajati jinapatiiJ karmalJii btidhyate na 1 eval!' lokesvaro 'hal!' tribhuvananilaye karmabhamyiil!' sthito 'rka satlViiniil!' mtirgadiitii narakabhayaharo niinyadevaiJ kadiicit 11194// 797

Translation, with some important commentaries of Bu-ston. 798 There is no commentary in theVP. Therefore, born, not lost, even being in the three existences, there is the suddhakiiya of the jina. He does not abandon at any time the well-being of the living beings. The master of jinas is not hindered by karma. So, I the lord of the world (lokeSvara)799 [Bu-ston: who is one who possesses KCT V:193. Banerjee. 1985:248; KCT in Tibetan: Bu-ston. 1965a:277-78. VimalaprabhaV.3 in VP VoLIII. 1994:130, line 12; VP in Tibetan. Bu-ston. 1965c:261, line 1-4. 796 Vimalaprabha in VP VaLlI!. 1994: 130. The VP commenting on verse KCTV:193. 797 KCT V:194; BaneIjee. 1985:248; Vimalaprabha V.3 in VP VaLlI!. 1994:130. Tibetan: Bu-ston. 1965a:278, line 2-5. There is no commentary in the VP to this verse. 798 Bu-ston. 1965a:278. The commentary on the laghutantra (KCT). 799 The Tibetan translates Loke.fvara with bCorn-ldan- 'das, which is the same translation as for Bhagavan. 795

154

the Suddhakiiya], am standing in the abode of the three worlds, in the kanna-world, Oh Siirya, giver of the way [Bu-ston: of liberation] of the beings, who takes away the fear of hell, there is never another god. KCT V:194 is even more interesting than verse 193. Here it is stated that the suddhakiiya ofthejinas is not being born from the beginning (iidyanutpanna, ni/:lsvabhiiva), iUs uncorrupted, and it does not have any desire, and fmally, it does not have any form. Also, the suddhakiiya is not bound by any karma bonds. All these characteristics are quite similar to the ones given to the Adibuddha in other parts of the Srz Kiilacakra and the Vimalaprabhii. However one can also see that the concept of suddhakiiya is more complicated. It appears that Buddha Siikyamuni could be qualified with this word. Arka is Silryaratha and here this must be Yasas speaking to Silryaratha.

5.2.3. Sahajakiiya as the supreme body.

In the following, the concept of sahajakiiya will be treated as it is found in Kiilacakra texts. The first example is from KCT II:27: idiinim iidhiiriidheya samudiiya ucyate guhyetyiidina _ guhyo~IJ'i~e ca nabhau sahajajinatanur nil;zsvabhiivasvabhiivii

hrccakre dh;annakayo bhavati hi nrpa sambhogacakre jinasya 800/ bindau nirmiiIJakiiyo bhavati guIJavaSiic cadhidaivakrameIJa hrccakra/'fl kanthacakra/'fl sirasi ca kamala/'fl dharmasal'flbhogasuddha/'fl //271/ 801

Here is described the origination of the support (iidhara) and the supported (iidheya) (Bu: iidhara = the six cakras; iidheya = the four bodies), beginning with "in the secret" and so forth. The Sahajajinatanu, which is without nature and with nature, [arises] in the secret, crown and navel [cakras]. Due to the efficacy of the properties [of the cakras], the Dhannakiiya arises in the heart cakra, Oh king, in the sambhogacakra of the jina. The NinniiIJakiiya arises in the bindu (drop). According to the succession of presiding deities the heart-cakra, the throat-cakra and the lotus on the head [are] the Dhanna [kiiya], the Sambhoga[kiiya] and the Suddha[kiiya]. VP II.2. The Vimalaprabhii commentary: iha sarfre ~at cakraIJY adharabhatiini catvaraJ:z kiiya iidheyaJ:z te~u sahajakayas trikamale~u svabhaviisvabhiivabhedena / ato guhyakamale u~IJi~akamale nabhikamale viSuddhakiiyo 'dhidevata nil;zsvabhiiva akaipanasvabhiiva pratisenopama / hrdaye dhannakayaJ:z kaIJthabje sambhogakayo 'dhidevata kiiyabhedena / bindav iti siraso 'bje suddhacakre ninnaIJakiiyo BaneJjee has: ca kanfhacakre api sambhogakiiyalJ. KCT 11:27. BaneJjee. 1985:50; Yima1aprabhii II.2 in YP YoU. 1986:170, line 12-25. Tibetan: Bu-ston. 1965a:54; Bu-ston. 1965c:332. Translated by Wallace. 1995:183.

800 801

155

'dhidevatii / kiiyabhedena niibhau nirmiilJacalere ninniilJakiiyo 'dhidevatii iti kiiyabhede niyama/;l / gulJavaiiid iti caleriilJii1fl gulJal} jiiiiniikiiiabhamigulJal} sahajakiiyiidhiirii¢m viiyugulJo dharmakiiyiidhiirasya tejogulJal} sambhogakiiyiidhiirasya udakagulJo nirmiilJakiiyiidhiirasyeti iidhiiriidheyabhiival} / uktaleramelJa hrccalerOlT' kalJfhacalera1fl iirasi ca kamala1fl dharmasambhogaiuddham iti /'02 Here in the body the six caleras are the support and the four bodies are the supported. The simultanely-arisen body (sahajakiiya) is in those three lotuses [caleras] due to the classification of own nature (svabhiiva) and-the lack of own nature (asvabhiiva) . Hence, in the secret-lotus (guhya), in the crown-lotus (u~lJf~a) and in the navel-lotus (nabhi) the pure body (viiuddhakiiya) is the presiding deity (adhidevatii), who is without own nature (nii}svabhiiva), whose nature is non-conceptualization (akalpanii) and who is like divination (pratisenii).'o, The dharma-body (dharmakiiya) is in the heart. The enjoyment body (sambhogakiiya) is the presiding deity in the lotus of the throat due to the classification of the bodies. In the drop (bindu), that is, in the lotus of the head, in the pure calera, the emanation body (nirmiilJakiiya) is the presiding deity. Due to the classification of the bodies, the emanation body is the presiding deity in the navel, that is, in the emanationcalera. This is an exact description with regard to the classification of the [four] bodies. "Due to the efficacy of the properties" [implies] the qualities (gulJa) of the caleras. The quality (gulJa) of primordial wisdom (jiiiina), space (akiiSa) and earth (bhami) belongs to the supports of the simultanely-arisen-body (sahajakiiya). The quality of the wind (viiyu) belongs to the support of the dharma-body. The quality of fire (tejas) belongs to the support of the enjoyment-body. The quality of water (udaka) belongs to the support of the emanation-body. This is the condition ofthe support and the supported. According to the described order, the heart-calera, the throat-calera and the lotus (calera) in the head are the dharma [-body], the enjoyment [-body] and the pure [body] (iuddhakiiya). Here there is a very systematic and interesting analysis of the correspondences between the four bodies and the six calaas, as they are defined in the Kiilacalera calera system. First the four bodies are defmed with reference to the concept of svabhiiva, that is, "own nature lintrinsic nature I the essential nature ofthe concept".

Sahajakiiya / Suddhakiiya - in the crown, navel, and secret calera Dharmakiiya - in the heart-calera Sambhogakiiya - in the throat-calera NirmiilJakiiya - in the head-calera (pure calera); also in the navel-calera according to the classification of the body Sahaja-jina-tanu (another way of saying sahajakiiya) is here defined as the one that as its own nature is without own nature(svabhiiva). The fact that it is defined in this way with VP II.2 in VP Vol.I. 1986: 170, line 12-25. Pra/isena appears to be a Sankritizied fonn of prasena which according to Bilthlingk. 176:2 means "eine Ar! Gauklerai" (a kind of conjuring). See Newman. 1988:133. '02

'03

156

reference to the word svabhiiva, also shows that it might be identified with the sviibhiivikakiiya. In chapter two of the KCT it is said that the mind has two natures. It is sasvabhiiva "with nature" which means that it has the characteristics of waking state and sleep. It is also nilJ-svabhiiva ~'without nature" which means that it has the characteristics of deep sleep and is without sense-faculties. 804 The context is also "ery clear. Here the correspondences between the cakras in the human body and the four kayas are described. Consequently, the sahajakiiya is placed in the u~lJf~a (at the top of the head) and the navelcakra and the guhya-cakra(the genital region), the dharmakaya in the heart-cakra, the sambhogakiiya in the throat-cakra and the nirmii1)akiiya in the bindu-point in the fore-head . (the third eye). As this is the inicrocosmos, one would expect to fmd the same correspondence in the first chapter Lokadhiitupatala, but there is no such evident correspondence. There is another classification of the four bodies according to the gulJas, which in this context appears to mean the six elements of the cakras.

[@1Q(quality,property) cakra - jiiiina (primordial wisdom) in the crown-cakra iikiisa (space) in the navel-cakra in the secret cakra bhiimi (earth) in the heart cakra Dharmakiiya - viiyu (wind) Sambhogakiiya - tejas (fire) in the throat-cakra Nirmii1)akiiya - udaka (water) in the fore-head-cakra Sahajakiiya

These correspondences describes aspects of the four bodies. In the final line of the verse the following concluding correspondences are to be found:

Suddhakiiya Dharmakiiya Sambhogakiiya -

in the head (fore-head) cakra in the heart cakra in the throat cakra

It is not easy to find a clear meaning from these correspondences, but I think that concerning the fourth body, the Sahajakiiya orSuddhakiiya, it is in the human body principally placed in the head, both in the u~lJf~a cakra and the cakra in the fore-head (the third eyecakra). The question also arises why this body is sometimes called Sahajakiiya and sometimes Suddhakiiya (or Visuddhakiiya); In this verse, they seem to be used as similar concepts as in verse ll:27; Sahajakiiya is placed in the crown, navel and secret cakras. In the Vimalaprabhii commentary, Visuddhakiiya is placed in the same three cakras. Consequently, there is no difference. Here follows a quotation from KCT 1:21 :

idiinf1fl dikpiilasthiinam ucyate _ piirve sakra 'gnir agnau yamadanuvarUl)ii yiimyadaityiipare~ viiyur yak~a haras ciiniladhanadahare~iirdhvabhiige tv adhas ca / brahmii Vi~(IUI; samastiil; parijanasahitiil; svasvadigralqapiiliis tanmadhye kiilacakra jinavarajanaka 'niihata vajrakiiyal; /12111 805 .04

KCT 2:19cd in VP Vol.I. 1986:165, lines 27-28 translated in Wallace. 1995:169. in VP Vol.I. 1986:73, line 25-29.

•0: KCT 1:21 Banetjee. 1985:6; Banetjee. 1959:50; Virnalaprabhii 1.8 157

Now are stated the sites of the direction protectors: Sakra is in the east, Agni is in the southeast, Yama, Danu, and VarUf}a are in the south, south-west and west. Vayu, Yak~a and Hara are in the northwest, north and northeast. Also, Brahma and Vi~lJu are in the upper portion and below. Anned, together with their retinues, they guard and protect their respective directions. In the middle of them is Kalacakra, the progenitor of the best ofthejinas, indestructible (anahata), the Vajrakaya. 806

In this verse there can be found a definition of Kiilacakra as "the one who produces the foremost among the jinas, he is indestructible and he is the vajrakiiya," and, as mentioned in the Vimalaprabhii commentary to KCT I:21. te~iil!' madhye kiilacakro jinaniil!'janako 'niihato vajrakiiyo dikpaliiniil!' prabhur ity arthal:z 1 807

In the middle of them is Kalacakra, the progenitor ofthejinas, the indestructible vajrakiiya, he is the overlord of the direction protectors.

Bu-ston has an interesting commentary to this text as follows: de dag rnams kyi dbus - nang dang snying ga 'i rtsa bcu 'j dus dang ga las g 'yon gyi rlung bcu 'i lte pa Ian chad 'khor 10 Inga'i dbus su thig Ie gnyis 'gro 'ong byed pa 'i dbus - su dus kyi 'khor 10 - rdo rje sems dpa' rtsa dbu ma rlung 'gag pa thig Ie 'dzag pa med pa Ihan skyes kyi ye shes phung po rnams bsgrib bral du sbyed par sbyed pas - rgyal ba rnams kyi skyed mdzad gzhom du med pa rdo rje 'i sku ste I phyogs skyong rnams kyi gtso bo shes bya ba 'i don to 1121 Kalacakra is in the middle of them in the outer. He is in the middle of the inner and the ten channels of the heart. He is in the middle of that which causes the going and coming of the two drops in the middle of the fiye cakrasthe navel (cakra) upwards - ofthe ten right and left winds. Since "Kalacakra" IVajrasattva, the cessation of the winds in the middle channel, the non-emission of the drop (bindu), the sahajajiiana (innate wisdom) - generates the separation ofthe aggregates (skandha) from obscuration (avarana), he is the "progenitor of the Jinas. 808

Important here is that Kiilacakra is defined in this way, which corresponds to the much more detailed descriptions in other places in the great commentary, the Vimalaprabhii. The Vajrakiiya is here the same as the svii.bhtlvikakiiya, the sahajakiiya and the suddhakiiya and also consequently the Adibuddha. 809 Very interesting is that Bu-ston here regards the jinas as a result of the separation of the skandhas from the obscurations (klesa). KiilacakralVajrasattva (and even Adibuddha!) then generates the jinas in that way. The generation being the process of taking away the klesas from the skandhas. This is clearly a 806 807 808 809

Translated in Newman. 1987a:513. Vimalaprabhli 1.8 in VP Vol. I. 1986:74, line 1-2. Bu-ston. 1965a:470, line 2. See my chapter on the Adibuddha concept above.

158

process going on in the inner as a microcosmos which has its correspondence in the outer as the deities KiilacakralVajrasattvalAdibuddha. Consequently, this verse and its commentaries treats the concept of "Adibuddha", although the word is not mentioned. B. BaneIjee in his dissertation81O takes this verse as an indication to strengthen the theory presented by B. Bhattacharya811 that the Kiilacakra tantra was presented as teaching aimed at uniting the Hindus and Buddhists against the invading Muslims. This verse treats the guardians of the ten directions, who are Indian deities. They are all placed under the dominion of Kiilacakra, so according to these Indian scholars, the syncretistic Kiilacakra teaching was composed in order to unite the Indians against the Muslims.

5.2.3.0. The subchapter on the four bodies, KCT V:89-90, the corresponding Vimalaprabhii and Tibetan commentaries.

A very interesting part of the fifth chapter treats the four bodies in an uddesa in KCT.V:89 -126, which also contains an extensive comment'lry in the Vimalaprabhii and is further commented on by the Tibetan commentators. This part of the text gives all the basics for the understanding of the system of the four bodies. I will start here by giving a translation of verse 89 with the Vimalaprabhii and the commentaries by Bu-ston and Zhang-zhung Chos-dbang grags-pa, the disciple of mKhas-grub-rje. I have given a translation of KCT.V:123-124 above in the context of writing about the quotations on the concept of Suddhakiiya (p.1S3). Here follows KCT V:89: na prajiiii niipy upiiyaf:z sahajatanur iya1[l dharmakiiyo babhiiva prajiiopiiyasvariipaf:z khalu vigatatamo jniinavijiiiinabhediit I so 'ya1[l sa1[lbhogakiiyaf:z pratiravaka iviinekasattviirthakartii sattviinii1[l piikahetor bhavati punar asau buddhanirmiilJakiiyal:z //89//812

That which is neither prajnii nor upiiya, the sahajatanu'IJ became the dharmakiiya. Prajnii (wisdom) and upiiya (means) are its own nature, indeed lacking darkness (tamas), because of the division into jniina and vijniina. So, [becoming] this sambhogakiiya, resounding like an echo, and being the agent for the sake of many intelligent beings, for the sake of maturing the living beings, it [becomes] the Buddha-nirmiilJakiiya. The context of this verse is that chapter V:89-126 of the KCT treats the subject of the four bodies of Buddha. It gives the principle of the Sahajakiiya, which is beyond the duality of wisdom and method (prajnii and upiiya). Dharmakiiya is divided into wisdom and method and the partition into jiiiina and vijiiiina is the origin of Sambhogakiiya, which also has sound. In chapter II:27 it was actually said that Sambhogakiiya is situated in the throatBaneIjee. 1959:50-51. Bhattacharya. 1958:109. 812 KCT.V:89. BaneIjee. 1985:222; Vimalaprabha V.2 in VP VoI.I1I. 1994:45, line 18. 813 Tib. Ihan-cig skyes-pa 'i sku; which is the usual translation of the Sanskrit sahajakiiya, consequently, tanu. is another word for kiiya. 810

Sll

159

cakra as far as the human body is concerned. In order to help human beings, the Nirmii1Jakiiya of the Buddha is necessary. Sahajakiiya beyond prajflii and upiiya Dharmakiiya - the division into jfliina and vijfliina Sambhogakiiya - sound; acts for the human beings Nirmii1Jakiiya - makes the human beings mature

This system will later be compared to other material on the four bodies. In the following, I have translated selected parts of the verses and commentaries concerning the four bodies. I have used the original Sanskrit text as published in India in 1994, but I have first translated them from the Tibetan, as the original Sanskrit text was not available to me when I initiated this work. I have also used Bu-ston's commentaries when they have added something of interest to the text. Bu-ston's commentaries are placed within parentheses. I start with the commentaries to verse KCT V:89, which is very important for understanding the theory of the four bodies in the Kiilacakra. Translation of the Vimalaprabhii commentary to KCT V: 89 with the commentaries of Buston: (p.45:14) na san niisan na sadasan'l4 na ciipy anubhayiitmakam I natvii kiiyaTfl mahiisukham II uddhrtaTfl mafljuvajrelJa iidibuddhiin niranvayiit I lak~Q/JaTfl buddhakiiyiiniiTfl caturlJiiTfl tad vitanyate II catu~kotivinirmuktaTfl

[Here is inserted the text of the verse KCT V:89, translated on the fore-going page] (p.45:22) na prajflety iidi I iha prajnii paflcadasakaliitmakal;t suklapa~al;t candrakaliihiinir upiiyal;t I evaTfl suklo riitril;t kr~1JO divii I atal;t sahajakiiyo na prajflii niipy upiiyal;t sahajatanur iyaTfl buddhiiniim I evaTfl na sac chuklapak~al;t niisat kaliibhiival;t kr~1JQ1;t na sadasad anayol;t parasparavirodhato meliipako niisti Ina ciipy anubhayiitmakam iti na ciibhyii'!l suklakr~1Japak~iibhyiim81S vinii tat sahajasukham I evaTfl catu~ko,iparisuddhii ~otfasi kalii silnyatiidharmi1Ji sahajatanur ucyate niMyandalak~alJiit turyiik~ayato yoginiim I (p.46: 1) evaTfl napuTflSakam iti siddham I iha sahajatanul;t sviirthasampat pariirthasampade dharmakiiyo babhilva su~upta~ayatal;t I sa ca prajflopiiyasvarilpal;t khalu vigatatamo jniinavijfliinabhediid iti I iha jfliinaTfl griihakacittaTfl yoginal;t vijfliinaTfl paracittajniinaTfl griihyaTfljfleyala~a1Jam I evaTfl griihakacittaTfl prajflii kalpaniirahitatviit yoginiim upiiyo griihyacittaTfl parikalpitaTfl karulJiilak~alJam I (p.46:5) tena griihakagriihyabhedena prajflopiiyasvariJpal;t pariirthakartii dharmakiiyal;t I sa ca sahajiid babhilveti I evaTfl ni'¥Yando niibhau sahajal;t dharmacakre hrdaye vipiikal;t so 'yaTfl dharmakiiyal;t saTflbhogakiiyal;t pariirthasampade pratiravaka iviinekasattviirthakartii I iha divyacak~u~ii kr~1Jap~aS

This is a quotation from Malamadhyamakakiirikii ofNagaljuna, Chapter I, verse 7. See Kalupahana. 1991:110. 815 The Vimalaprabhii text has -lq-;pak;a but from the context it must be -kT!f.lapak;a. 814

160

yad atltanagatal!' rupal!' dr~ial!' pratibimbakiiram svaccham tasmin sabdo yo niscarati sa pratisabdal;t sambhogakiiyal;t prajiiopayasvarupal;t I (p.46:9) divyasrotrer;a divyavijiianal!' grahakam pratisabdo grahyal;t I tenatftanagatakiilasal!'khyal!' janati 'mukakalpe 'mukayuge 'mukavar~e 'mukamiise 'mukapak~e 'mukadiniidike 'muko bhutal;t amuko bhavi~yatfti I tena sativa vaineya iti svapnavasthak~ayatal;t kar;rhe puru~akiiral;t sambhogakiiya urdhva retasal;t I satlvanal!' pakahetor bhavati punar asau sambhogakiiyo nirmar;akiiyo bhavati prajiiopayatmakal;t I (p.46: 14) eko 'pi satlvanal!' nananirmar;adarsanato 'nekal;t I evam ekiinekayor yogo vivrtya prajiiopayal;t sal!'vrtya ekanekavirodhal;t I sa ca jagradavasthak~ayato lalare vaimalyo nirmar;akayal;t ase~arupasandar§l ratnaketur mahamar;il;t (na sa 8.24)'16 iti I evam ekal;t sahajal;t sa eva dharmal;t sambhogo nirmar;as eeti eaturdheti (p.46: 17) II 89 II 817 (tib. p.80:1; sk!. VP voWl 1994 p.45:14) [The Sanskrit text in translation:] There is no existence or existence and no existence or non-existence and there is even no [existence]ofthe essence of the two together. After having paid respect to the body with the great bliss and which is beyond inherent existence and [the statement] that something is, is not, both is and is not, neither is or is not'I'. Drawn out from the Adibuddha without connection (unconnected)'I. by Maiijuvajra, the characteristic of the four bodies of the Buddha is to be explained. [Here is inserted the earlier translated verse KCT V: 89] (p.45:22) "There is no prajiia, etc." As for this prajiia, it is the essence Wayman. 1985:93, Davidson. 1981:30,57. KCT.V:89. Banerjee. 1985:222; VimaJaprabha V.2 in VP Vol.ID. 1994:45, line 18-21. From Bu-ston's edition of this text in Tibetan. Bu-ston. 1965c Part 3, p.80, line I -p.82, line 3. Sk!. Vimalaprabha V.2 in VP Vol.IlI. 1994:45, line 22 - p.46, line 17. See Edgerton 1972 (1953):223. Catu.,ko!i is a short way of saying what is said in the former sentence, namely "that something is, is not, both is and is not, neither is nor is not." This paradoxical statement is typical of Nagtiruna 's text. He expresses contradictions and it is often not very clear what he means. 81' The translation of the word niranvaya is problematic. It can be translated as "without family, unconnected, without causal connection, without partiality, without parts, etc." The translation is important for the interpretation of the word Adibuddha. All the translations have the same meaning of giving the meaning of something beyond. But if it is translated as beyond causaf connection, etc., it signifies an interpretation of the word Adibuddha as a cosmic concept, as an entity beyond everything in the world and it has no causal connection with this world, but it is anyway in some way at the origin of this world. The expression Adibuddho niranvayal;z was already used in the MNS Cas treated in this work on p.74 and notes 473 and 474) and the expression is crucial for the interpretation of the Adibuddha concept in the whole of the KCT and the VP. This is one of the best indications found for the cosmic interpretation of the concept. There exists another possible interpretation. Adibuddha simply could be taken as the root-tantra and the author of the KCT Maiijusrfyasas has drawn out the characteristics of the four bodies of the Buddha from that text and in that case there is no room for a cosmic interpretation. My conclusion is that it probably is the cosmic concept which is aimed at in this text, because in the MNS 100 it definitely is the cosmic concept that is described. The word niranvaya as describing the Adibuddha is used in both MNS and the VP and it is most probable that the author of the VP has quoted from the MNS, as this text is of fundamental importance for the Kfilacakra texts. 8)6

817

'I'

161

of the fifteen parts (kallis)"· of the month which is the bright part of the month. Upiiya is the dark half of the month and it is the decreasing [of the fifteen] lunar parts (ka/lis). Accordingly, the bright part is the night and the dark part is the day. Subsequently, the sahajakiiya is not prajiiii and is not even upiiya, it is the sahajatanu of the Buddhas. 821 Accordingly the bright part of the month [the first half of the month] is non-existent, there is also not a dark [half of the month] as it is consisting of unreal parts (kaliis); neither is real or unreal. As there is no existence and non-existence, they are not brought together, because there are contradictions of the two opposing ones (Bu: the two of them are imputed phenomena). (tib. p.80:S) As for "there is not even the non-existence of the two together", that is, the bri ght and dark halves of the month are not deprived of the sahajasukha (the simuItaneouslyarisen bliss). (p,4S:26) Thus, the sahajatanu is said to be the complete purification that something is, is not, both is and is not, neither is nor is not,822 and the sixteen parts of the month (kaliis) and possesses the characteristics of the voidness; and because it is characterized by flowing, and because of the imperishable fourth [state] of the yogins. (p.46:1) In that way, it is proven that it is neither male nor female. Thus, from the sahajatanu being accomplished for the sake of itself, and being accomplished for the sake of others, became the dharmakiiya, the sleep having ended. And, that one [the dharmakiiya] has as its very nature prajiiii and upiiya, indeed, being without darkness (tamas), due to the classification intojiiiina and vijiiiina. Here, jiiiina is the mind which has been grasped by the yogin and vijiiiina is known as thejiiiina of another's thought and [it has] the characteristics of that which is to be known and that which is to be grasped. In this way, the mind which grasps is prajiiii, because it is lacking in mental constructions; the yogin's upaya is perceptible thought, determined, characterized by compassion. (tib. p.81:3; p,46:S) By the classification into that which has been grasped and that which is going to be grasped, the dharmakiiya, with the own nature of prajiiii and upiiya, is the maker of benefit for others. And that one [the dharmakiiya] has originated from Sahaja [-kiiya]. Thus, sahaja, because it is flowing in the navel, now it has been ripened in the dharmacakra [and] in the heart it is this dharmakiiya, as it is excellent in doing benefit for others, it becomes the sambhogakiiya, who, like an echo acts for the good of many living beings. (p,46:8) Here, with the divine eye, the form without past or future is seen as a reflected form, perfectly transparent; in that [perfectly transparent form] the sound that is the echo, the sambhogakiiya, and the very own nature ofprajiiii and upiiya. (p,46:9) With the divine ear, the divine consciousness (vijiiiina) is the subject and the 15/60~ of a degree (Hartzell. 1997:1206). This refers to IS parts of each lunar fortnight, IS segments of waxing/waning moon. 821 Accordingly the Buddhas (plura!!) have a sahajatanu (a simultaneously-arisen or innate body), that is, something beyond the duality ofthe existence. B22 The earlier mentioned catu~ko!i (note 818).

82. According to Hartzell, this is

162

echo is the object. Therefore, the calculation oftime in the past and in the future is known, in such a kalpa, in such a yuga, in .such a year, in such a month, in such a fortnight, in such a day and so on. Such and such occurred, such and such will be (p.46: 12). Therefore, the living beings are to be taught; through the dissolution of the imperishable sleep (the dream state), in the throat, human effort is the sambhogaktiya, because of [keeping] the semen above.(tib. p.81 :7) For the sake of maturing the living beings, this one again becomes the sambhogaktiya, it becomes the nirmiil}akiiya, the essence of prajiiii and upiiya. Though one of the living beings, because of seeing its various emanations, [it appears to be] many. Thus, the union of one and many is evidently prqjiiii and upiiya.(p.46: 14) As for the relative truth (safTlVrlya), it is contradictory one and many. It is also, through the dissolution of the waking state, in the fore-head [cakra 1 nirmiil}aktiya deprived of impurities, (Bu: The own nature (svabhiiva) of mahiisukha is in accordance with the thought of being disciplined [by dharma]), "the completely visible form, the Ratnaketu, the great gem, (Bu: Because it is placed in the great gem)".823 (Bu: For the sake of accomplishing all beings, the characteristics of the precious gem of bliss [have been given].) (tib. p.82:3) Thus, Sahaja [-ktiya] is one, and there are four separate kinds: this very one (Bu: sahajaktiya), the dharma[-kiiya], the sambhoga[-kiiya] and the nirmiil}a[ -kiiya]. (p .46: 17) (Here is the end ofthe translation of the commentaries to verse 89). Strangely enough, in this text it is given that the four bodies are placed in the human body in the following way: Sahajakiiya is placed in the naveI-cakra, Dharmakiiya is placed in the heart-cakra, Sambhogakiiya is placed in the throat-cakra and fmally, the Nirmii1)akiiya is placed in the cakra in the fore-head. This is reversed from the order which is found in the second chapter, but is in accordance with the division found in KCT II:27 with commentary. In the following some characteristics of the bodies found in this text, especially the Sahajakiiya and the Dharmakiiya. There is a correspondence between the concepts of prajiiii and upiiya and the month divided into two parts. The fIrst fIfteen days, the bright part of the month, corresponds to prqjfiii (wisdom) and the last fIfteen days, the dark half of the month, to upiiya (method, skillful means). Sahajakiiya is neither part of the month and belongs to the Buddhas. There also exists a concept called the sixteenth part of the month which is completely pure (suddha) and has a connection with the Sahajakiiya concept. The sixteenth part of the month must mean something beyond no=al existence, as it does not really exist, as there are only 2 times 15 days in the month. Later on in the text (p.80:7; p.46:1), there is something very interesting. It is said that the Sahajatanu (-kiiya) was made into perfection for the benefIt of itself. Another confIrmation of the transcendence of the concept. Sahajakiiya does not need anything or anyone else. It is beyond these concepts. It is said to be in a sort of sleeping state and waking up

82' This is a quotation from the Niimasangfti 9.24. See translations by Davidson. 1981 :30, 57 and Wayman. 1985:93.

163

from sleep it becomes the Dharmakaya. Having become Dharmakiiya, this body can be made into perfection for the benefit of others. It is a change of state of a Buddha. The classification into that which grasps (griihaka) (subject) and that which is going to be grasped (griihya) (the object) is the Sahajakaya and the own nature (svabhiiva) ofprajiiii and upiiya is the Dharmakaya. It is clearly said in the commentary that the Dharmakaya has its origin in the Sahaja [-kaya]. Sahaja was caused by a former life in the navel-cakra and in the following it ripens in the heart-cakra. This could be an indication of the concept of something indestructible, continuing from life to life. When the dharmakaya actually is doing benefit for others it becomes sambhogakaya, who acts like an echo, that is, sound is involved. This information can be connected with the information cited above from chapter II, which places the samhhogakaya in the throat cakra.

.

.

Before continuing with an analysis of this text, I will treat another commentary which is of interest for clarifying certain themes. It is the commentary by Zhang-zhung Chosdbang grags-pa 824 who became. abbot of a monastery in Chamdo in 1458 and died inI469. 825 He was a disciple of mKhas-grub-rje (1358-1438) who was a disciple of the great reformer of Tibetan Buddhism Tsong-kha-pa (1357-1419). His commentary forms part of the collected works of mKhas-grub-rje and is probably the interpretation of the Kiilacakra as put forward by Tsong-kha-pa, who had the Kiilacakra tradition from Bu-ston. Tsong-kha-pa himself wrote very little on the Kiilacakra and left it to his disciples, principally to mKhas-grub-rje to comment on this tantra. This commentary to the fifth chapter the Jiiiinapataia of the Vimalaprabhii, is very voluminous, containing 463 pages, compared to Bu-ston's 293 pages. The commentary to the 2nd mahii-uddesa, which treats the four bodies, etc., is 72 pages, compared to Bu-ston's 21 pages. A very interesting feature of this commentary is that it claims in several places that it reveals things about the subject that have not been written before. Some important information from the text follows:

Translation and summary of the commentary on KCT V:89 by Zhang-zhung Chosdbang grags-pa. Tibetan text: (p.290:7) gnyis pa sku bzhi la sogspa'i rnampar (p.291:1) dagpa nges pa'i mdor bsdus la gsum / mchod par brjod cing brtsam par dam bca' ba / mdor bsdus Icyi gzhung bshad pa / mdor bsdus Icyi mtshan bstan pa '0 / dang po ni rang bzhin gyis yod pa ma yin pa med par rang bzhin gyis (p.291 :2) grub pa ma yin / yod med gnyis ka rang bzhin gyis grub pa min cing yod med gnyis ka'i bdag nyid min pa 'ang rang bzhin gyis grub pa min par mtha' bzhi las ni rnam par grol ba'i bden stong dang bde ba chen po grub bde dbyer med 'bral mi rung du (p.291 :3) tshogs pa ngo bo nyid Icyi sku la phyag 'tshal nas zhes pa ni ngo bo nyid Icyi sku la bde stong gnyis yod pa 'i bden pa 'i mtha' bzhi las grol ba'i tshul yin la I bde chen mtha' bzhi dang bral ba ni 'og 'grel pas 'chad pa 'i skabs su 'byung ngo II dang po 'i (p.291 :4) sangs rgyas ris med las I zhes pa nas Imtshan nyid de ni dgrol bar byalzhespa'i bar go sla'oll 824 B2S

Zhang-zhung Cbes-dbang grags-pa in Mkhas-grub-Jje, Vel.5, 1983:161-623. Bod-rgya tshig-mdzod chen-rna, Beijing. 1985: 3249-3250.

164

(p.290:7) [the commentary on verse KCT V:89 starts]

In the second uddefa on the instruction (niyama), the purity and the perfection of the four bodies etc., there are three parts: [1] the homage and promise to compose the texts [2] the explanation text of the uddefa, [3] the explanation of the name uddefa. [I] All for the 1st, there is no existence in its own nature and there is no existence in its own nature, and there is no state of perfection (p.291 :2). The two, existence and non-existence, not having perfection in their own nature, even when not being the essence of two, existence and non-existence, there is no perfection (siddhi) of its own nature. The truth, which is entirely beyond the belief in the inherent is that the void (sunya) and the Great Bliss (Mahasukha) are inseparable as the bliss that arises from the union with sunyatii. After having paid homage to the sViibhiivikakiiya in which they have come together, it is unsuitable for them to be separated; here is the way of being freed from the belief in the inherent, which is the truth that has the two, mahiisukha and §unyatii, in the sViibhiivikakiiya and as for the mahiisukha being deprived of the belief in the inherent, because it is going to be commented upon below, it will be put forward in the chapter of explanation (p.291:3). From the unconnected Adibuddha (tib. ris-med; skt. niranvaya), from what is said like this, it is going to be liberated from the characteristics. This is easy to understand."'26 (End of direct translation. The following is a short condensation of the rest of this subchapter which treats how the fourth body is related to the other ones. There are no direct quotations.)

On p.291:7 the text continues treating the sahajakiiya. Inner, outer and other Kiilacakra have prqjnii and upiiya. Then on (p.293:2) the text continues to explaining the essence of sahajakiiya. From the body-side of the Sahqjakiiya there is the body provided with the dhanna of the emptiness image (tib. stong-gzugs; skt. sunyatii-bimbam) and from the mind-side of the Sahajakiiya there is the great bliss (Mahiisukha) which is unchanging and sahqja (=innate, simultaneously-arisen). These two are inseparable as the water is from the wet and this kind of body is called Sahajakiiya. Consequently, from the side of the body it is called Sunyatii-bimba-kiiya (tib. stong-gzugs-kyi-sku), void-fonn-body and from the side of the mind (tib. thugs, skt. citta) it is called Mahiisukhakiiya (bde-ba chen-po'i sku), the body of the great bliss, and Sahajakiiya (tib. lhan-cig skyes-pa'i sku), the simultaneously-arisen body. The object of experience of the mind has two purities, from that side it is called the SViibhiivikakiiya (tib. ngo-bo nyid-kyi sku), the selfexistent body. If this Sahajakiiya has the fonn of sviibhiivikakiiya, it needs to have the two purities (tib. dag-pa, skt. suddha). Therefore sViibhiivikakiiya is like composite existence (p.293:5) . •26 Zhang-zhung Chos-dbang grags-pa, p.290:7 - 293:1 in mKhas-grub-Ije, dGe-legs-dpa1-bzang-po. The Collected Works ofmKhas-grub-lje, Vo1.5, 1983:161-623 (This is the commentary on KCT V:89 and the commentary on that verse VP V.2.).

165

Now, the next subject is that on top of the bindu of the Fourth state there is something like an atomic level. The one composite existence which has the potential that is born out from the Mahiisukha (the great bliss). This has been said before in the com-' mentary of the text (rdzogs-rim) rnal- 'byor chen-po'i bshad-pa by rJe-btsun bfa-ma (Tsong-kha-pa). Zhang-zhung considered that earlier scholars had not explained this clearly, and that he explained it to satisfaction. When someone reaches the samiidhi, ultimate stage of the six-limbed yoga, he has piles of bindu stacked on each other in the central (avadhati) channel and they do not have the substance of own nature. The great bliss comes out of this. It is the Fourth State (of sexual bliss). This bliss is created from the sexual experience. It is like real bliss or like the bija-bliss on an ordinary level. Here again, the author states that noone has previously stated this about the sViibhiivikakiiya. When one reaches that state one obtains the bindu, and by practising this unchanging great bliss one reaches the fourth stage (p.294: 1). One can then see the differences between the sambhogakiiya and the sviibhiivikakiiya. The first mentioned has more of the body-side and the second one has more of the great bliss. They are not male or female. Sahajakiiya is more for the benefit of oneself and it has two parts, body!the void (tanya! body and mindlmahiisukha ), and here it has been told about the mind-side. (The explanation of the characteristics of the other three bodies follows): Void-form-body is upiiya and the body-side and the Great Bliss is the mind-side and prajfiii. There are different opinions about the relationship between prajfiii and upiiya. Someone (Dol-po-pa) says that on the absolute level there is no rejection between upiiya and prajfiii, they are equal. Then another person, Ka-ye shes-pa-can explains that they are not equal at all. (p.296:2) Explanation of Dharmakiiya: when one stays in a state of sleep, one is the Dharmakiiya, which is not dharma and not form. From dharmakiiya one can be divided into ye-shes and rnam-shes (jfiiina and vijfiiina). Withjfiiina one can go into Buddhahood and the great bliss. Vijfiiina is the sTong-gzugs (empty form) side which is aimed more for helping others. (p.297:1) The mind and bliss side in union is sahajakiiya. When prajfiii and upiiya comes into action for other beings, it is dharmakiiya. Sahaja is connected with the navel in the body. Sahajakiiya is staying by itself and when it tries to turn for the benefit of others, then turns it into dharmakiiya. When in some way sound (tib. gsung; word, sound, voice) comes into the context, dharmakiiya turns into sambhogakiiya. On p.300 there is a short passage which tells about how the three other bodies come out from the sahajakiiya. By the main male (Kiilacakra), the five Buddhas are manifested which are the purified skandhas. By the main female (Visvamiita), the five "mothers" (female aspects of the jinas) are manifested which are the purified dhiitu's. The main male and female makes manifest the object and subject. 827

821

The entire Tibetan text is given as Appendix 1 to this dissertation. Zhang·zhung Chos·dbang.grags-pa, p.

291:4-297:2.

166

The text by Zhang-zhung Chos-dbang grags-pa states some interesting points. There exists some original unity caned sviibhiivikakiiya, sahajakiiya or iidibuddha and it contains the two ·sides mahiisukha and sunyatii or prajnii and upiiya. Sahajakiiya contains two sides, the body-side and the mind-side sahajakiiya - is existing by itself and the great bliss (mahiisukha)side and the void(sunya)-side are united in the sahajakiiya as the water is from the wet. It can be seen as another way of denominating the content of the concept of A.dibuddha sahajakiiya

~

-mind-side: mahiisukha (ak~ara and, sahaja) called mahiisukhakiiya and sahajakiiya

---

- body-side: void-fonn-body (sunya-rupa-kiiya); sunyatii (the void)

Two purities; the sViibhiivikakiiya which is like composite existence - prajnii

- upiiya

- bindu - the ultimate samiidhi stage ofthe ~a4aTJga-yoga dharmakiiya - comes into existence when the sahajakiiya is turning into benefit for others. It comes into existence when one stays in a state of sleep. It divides into: dharmakiiya

/

jniina (knowledge) withjnana one can reach the great bliss and Buddha-hood

~ vijniina (discriminating knowledge) this is again the empty-fonn side which is aimed at helping others

sambhogakiiya - is when the sound comes into existence. The level when the sound begins to be transferred to the living beings.

nirmiiTJakiiya - is the definite level where the teachings for maturing the living beings can be done.

This analysis of the text of Zhang-zhung Chos-dbang-grags-pa corresponds wen with the above presented text of KCT V:89 with the VP commentary. The main principle is that the four "bodies" (kiiya) of the Buddha are presented in a cosmological context where these

167

"bodies" have special characteristics. The original level of sahajakiiya can be compared to the concept of an original principle as the concept of A.dibuddha. This concludes the commentaries to verse KCT V:89. The following verse is also very in- . teresting for the four bodies, so here verse KCT V:90 is quoted:

eko 'sau vajrasattvaiJ pralayaghananibho heruko vai babhu~a raudra1Jlirr pacanartharr sa ca samayajino mohitanarr sukhartharr 1 ratne~o duiJkhitanarr sa ca kamaladharo ragi1Jlirr ragahetor vighnanarr dhvarrsanartharr tv asikarakamalo 'moghasiddhir babhuva 1/90// 8" One is this Vajrasattva, who is like the cloud of universal destruction, [he] is indeed Heruka; He is also the samayajina, for the sake of maturing the raudras and for the happiness of the confused. [He is] the jewel-master [Ratnasambhava] of the tormented, and the lotus holder for the sake of the passion of the passionate. For the sake of the destruction of the hindrances, he is also Amoghasiddhi, with sword and lotus in hand. In the commentary of Zhang-Zhung chos-dbang grags-pa it is said that Vajrasattva and Kalacakra are essentially one. The black Heruka originates like a cosmic cloud in the mG1:u!ala of Cakrasarrvara and others. 829 Heruka is, according to Tucci, an independent deity with his own malJ¢ala and also a generic head of the Buddha-families of the anuttara-yoga-tantras and can be referred to in the context of Cakrasarrzvara, Hevajra and Kalacakra. 830 In this context, he is used as a denomination of Vajrasattva. Thus, by Vajrasattva, Cakrasarrzvara-Vajrasattva has been manifested and by the main male Kalacakra- Vajrasattva the other four families have been manifested. This is the pure essence of the five Buddhas. In Davidson's article it is noted that Heruka is an emanation of Vajradhara on the same level as the deity Mahesvara. Essentially, all these deities are the Mahavajradhara.83 I In the Cakrasarrzvara Tantra, Sri Heruka signifies non-dual experience, the void, uncompounded and not abiding anywhere. These are qualifications which also can be applied to KalacakralA.dibuddha. 832 rJe blo-gros chos_skyong833 explains in his commentary to this verse how the Buddhas emerge from the four bodies. First, the five jinas emerge, then their female counterparts, then the bodhisattvas, then the kro¢has. He also states that all these together are the Dharmakiiya. From the Sahajakiiya, Vajrasattva emerges in the form of the black Heruka, who has come from the black cloud. From Sahajakiiya cVajrasattva emerges Heruka - Vajrasattva and after that the fivejinas. 834

8" KeT. V:90. BaneIjee. 1985:222;

VimalaprabhiiV.2 in VP Vol.III. 1994:46, line 18-21. Tucci. 1988: XV-XVII, 61-62; Davidson. 1991:203-214; Schumann. 1986:212,277; Abhayilkaragupta, 1949 (Ni,pannayogava/i), p.20; Wayman. 1973:234-235. . 830 Tucci. 1988:XV-XVI. 831 Davidson. 1991 :208. m Shrichakrasambhara Tantra. 1919:3. 833 rJe blo-gros chos-skyong has like Zhang-zhung Chos-dbang-grags-pa written a commentary on this chapter which is included in the collected works ofmKhas-grub-lje. He was a disciple ofmKhas-grub-rje, 834 rIe blo-gros chos-skyong. 1983, p.I35:6 - p.136:2. 829

168

mKhas-grub-rje writes in his "Fundamentals of the Buddhist Tantras,,835 that the svabhiivikakiiya of a Buddha means the same as the Tathiigatagarbha (the embryo of the Tathiigata). He cites Bu-ston as a defender of this theory. In his final analysis, mKhas-grub says, though, that the svabhavikakiiya is not the Tathiigatagarbha. In another context mKhas-grub states that Anandagarbha says in the Sri Paramaditikii 836 that the four bodies correspond to the four jinas, svabhavikakiiya is Vairocana. Here some similarities can be noted to the AdibuddhalMahavairocana-concept in the Japanese Shingon-buddhism.

5.3. CONCLUSIONS.

I have tried above to analyse the theories of the fourth body and its connection with the Adibuddha concept and will this analysis not be repeated here. It is possible to see some lines of development of the Adibuddha concept in connection with the svabhavikakiiyasystem of the four Buddha-bodies. Already in the Abhisamayalal!lkiira, and especially in the commentary to this text by Haribhadra, one can find information on the svabhavikakiiya that point forward especially to the concept suddhakiiya (the pure body) which is found in the main Kalacakra text. As yet, I have not seen in any literature that the fourth body should be named suddhakiiya, as in the Kalacakra texts. Haribhadra writes about the fourth body that it is visuddha(pure). There is a line leading back to these texts, over the developed concept of svabhiivikakiiya (self-existant body) to the Adibuddhaconcept. The sahajakiiya is here also said to be beyond the duality of prajfia and upaya and can conseqentlybe seen as being on the level of the Adibuddha principle. Compared to the Japanese Shingon-Buddhism where Mahavairocana is regarded as the dharmakiiya in the three-kiiya-system,837 in the Kalacakra texts Adibuddha is probably to be identified with the svabhiivikakiiya in the four-kiiya system. The Kalacakra-texts

have not been translated into Chinese, and therefore have not been able to have any influence on the Japanese Shingon-Buddhism.

'" Lessing & Wayman. 1968 Toh.2512. B37 Mahavairocana-sUlra. Trans!. by C. Yamamoto. 1990.

83'

169

6. PARAMA~ARA - THE SUPREME UNCHANGING. ITS RELATION TO THE ADIBUDDHA CONCEPT AND THE SAHAJAKAYA.

6.1. THE SUPREME UNCHANGING AS PRESENTED IN KCT V:127 AND THE VIMLAPRABHA COMMENTARY. In the Jfiana-para1a (the chapter of knowledge), chapter V of the laghutantra SrfKalacakra-tantra-raja (KCT), and the commentary Vimalaprabha (VP): The mahoddesa (subchapter), Paramak~ara-jfiana-siddhi (The supreme unchanging perfection of knowledge). KCT V:127, with the VP commentary.8J8 Tibetan: Vimalaprabha in Bu-ston's edition. 839 Without comparison, this is the verse which has the most extensive commentary in the whole text of the KCT. It has a commentary of 60 pages in the Sanskrit original of the VP and 114 pages in Bu-ston's Tibetan edition. I have worked with this text using at first the Tibetan translation as I first had access to the Tibetan and only later to the edited Sanskrit text. The following is a presentation and translation of verse KCT V:127 and a partial translation of the commentary Vimalaprabha. The commentary is the third subchapter within the fifth main chapter. This verse treats the concept of paramak~ara, the supreme unchanging; paramak~ara-jfiana, the knowledge of the supreme unchanging; paramakeara-jfiana-siddhi, the perfected knowledge of the supreme unchanging ; parama~ara-sukha, the bliss of the supreme unchanging; paramak~ara-sukha-jfiana, the knowledge of the bliss of the supreme unchanging. This concept of the supreme unchanging approaches the concept of Adibuddha which has been characterised in other contexts in these texts as unchanging, beyond duality, etc. 840 The Sanskrit word can be analysed as parama - ak~ara, "the supreme" and "the imperishable or unchanging" or, in French, "inalterable, qui ne passe pas.,,841 The word a~ara can be analysed as a-~ara, a negation of k~ara which means "melting away, perishable.,,842 Consequently the word paramak~ara can mean "the indestructible" or, as I have interpreted the word, as "the unchanging." The meaning is practically the same. In the word "unchanging" is also implicit the meaning that it is something that cannot be destroyed. Before treating verse KCT V: 127 and the accompaning VP text, some parts of the introductory part of the Vimalaprabha will first be presented. In the introductory verses of homage in the Vimalaprabhii, Paramadibuddha is described as: Vimalaprabhii, chapter V, subchapter 3 in VP VoUII. 1994:60-103. Bu-ston. 1965c:101, line 3-216. 840 See the previous chapter on "Adibuddha in the Kalacakra Tantra n • 841 See Stchoupak, Nitti, Renou, Dictionnaire Sanskrit-Franqais. 842 See Monier-Williams 1976 (1899). 838

839

170

utpiidavyayavaTjito

'k~ari:lsukho

the unchangi~g bliss and the. abandonment of origination and annihilation ... 843 Later in the introductory part:

paramiidibuddhenetiparamiidibuddhal,! ekak~alJapaFiciikiiravif!lsatyiikiiramiiyiijiiliibhisambodhila~alJo­

'lqarasukhal,! paramal,! teniidibuddha paramiidibuddhal,! tena paramiidibuddheneti I niranvayeneti I The Paramiidibuddha is the unchanging bliss that is characterized by perfect enlightenment in a single instant, in five aspects, in twenty aspects, and by the net of illusion; it is supreme (paramal,!; mchog). The one who first obtained Buddhahood (iidibuddha) by that [bliss] is the Paramiidibuddha. The Paramiidibuddha [taught the tantraJ. 844 From these two quotations it can be seen that the Paramiidibuddha in this text not only is the root-tantra or the malJljala, but also is actually the one who first obtained Buddhahood and the unchanging bliss. It is even indicated that it was Paramiidibuddha who taught the tantra. This should not be interpreted that Paramiidibuddha is Sakyamuni Buddha. Rather, it is that Buddha when he was teaching the Kiilacakra at the Dhiinyakataka stiipa appeared in the shape of KiilacakralAdibuddha. Paramiidibuddha here really emerges as a kind of personified principle that first obtained Buddhahood. These are quite strange ideas for mainstream Mahiiyiina buddhism. It presents serious problems as to who really obtained Buddhahood, as the Adibuddha is supposed to be timeless. Is there a beginning in time? Further on in the same chapter is written:

kalo 'lqarasukhajiiiinam upiiyal,! karulJiitmakal,! I jiieyiikaral'!l jagac cakral'!l srf prajiiii siinyatiitmika II Time (kala) is the wisdom (jiiiina) of unchanging bliss - the method consisting of compassion. The wheel (eakra) is the world in the aspects of objects of knowledge - the splendid wisdom (prajiiii) consisting of emptiness. '45 Later, there is an explanation of the word Kiilacakra:

kalal,! paramiilqaro mahiisukhalalqalJal;t tenotpiidital'!l niriivaral'!l skandhadhiitviidikal'!l cakral'!l yasya sarfram asau kiilacakral;t I

Virnalaprabha 1.1. in VP Vol.I. 1986:1, line 4; Newman. 1987a:222; Bu-ston. 1965a:302. Virnalaprabha I. 2 in VP Vol.I. 1986:17, line 9-11; Newman. 1987a:270; Bu-ston. 1965a:333; see p.78-79 for the Sanskrit text. .45 Virnalaprabha I. in VP Vol.I. 1986:11, line 13-14; Newman. I 987a:243; Bu-ston. 1965a:316. .43

'44

171

Time (kitla; dus) has the characteristics of the great bliss of the supreme unchanging. One whose body is generated as a wheel (calera; 'khor-lo) of unobscured skandhas (aggregates), elements, and so forth by means of that [bliss] is Kiilacakra. 846 From these two quotations one can see that Time is a key concept in the text. It is the supreme unchanging bliss which places the concept on the same level as the Paramiidibuddha, beyond the transforming world. This is in harmony with the statement at the beginning of the first chapter of the laghutantra, where time is at the origin ofthe emanation of the world. 847 . There is an interesting section in the fifth subchapter of the first chapter of the Vimalaprabha which treats the Vajrayoga and the problem of the ultimate truth. I have translated part of this subchapter in the chapter on the iidibuddha in this work (p.84-85). The supreme unchanging (paramii~ara) is equalled to the union of wisdom and method, the vajrayoga, Adibuddha and Kiilacakra. Next a quotation from the VP commentary on KCT I: 1:

asau visuddho vajrayoga ekak~Q/JiibhisambuddhaJ:t san mahiirthaJ:t sahajiinanda/:l na kiimabhave sthita/:l na rupabhave sthita/:l niirupabhave sthita/:l 848

paramii~araJ:t

This pure vajrayoga, the highest, perfect Buddhahood in one moment, the noble great aim,the supreme unchanging, the sahajiinanda does not abide in the desire existence. It does not abide in the [sixteen] form existences. It does not abide in the [four] formless existences. This vajrayoga seems to be a concept that signifies the transcendent. All the enumerated concepts are descriptions of the vajrayoga which is the practice. 849 The supreme unchanging is consequently not a part of any form of existence. Another place where the concept of paramiik~ara is treated is the following commentary on KCT I from the VP 1.5: ihaikak~aTJiibhisambodhir niima paramiik~arasukhak~aTJa

iti / asau bhavati iviisasarrJchyiinta/'fl yiivat / tata/:l purTJas tasmin k~alJe 'bhisambuddha/:l samyaksambuddha iti / iha yasmin purlJa~alJe sarvatathiigatii abhisambuddhiis tasmiit ~aTJiit sarvadharmiiTJii/'fl notpiido na sthitir na bhanga/:l niranvayatvat8SO eka~anasambuddhal:z sarvak~aTJavibhiivako

Here, the so-called highest, perfect enlightenment in one moment is a moment of supreme unchanging bliss. This highest, perfect Buddhahood in one moment Yimalaprabhii I. In VP YoU 1986:17, line 12-14; Newman. 1987a:271; Bu-ston. 1965a:333. KCT 1:4. In VP Yol.1. 1986:53,line 26. Because of time (kala), from the voids, wind,fire,water ... originate in the middle of the void ... " See the fore-going chapter 3.1, p. 79. 848 Yimalaprabhii 1.5 in YP YoU. 1986:44, line 6,7. 849 See Newman. 2000/2001 for an investigation of "Yajrayoga in the Kalacakra Tantra." 850 Yimalaprabhii 1.5 in VP Yol.l. 1986:44, line 12-15. Translated by Newman. 1987a:374. 846 847

172

is the person developing all the moments through to the end of the count of the breaths. Then, the highest, perfect Buddhahood in that moment of completion is the true, perfect Buddha. Here, after that moment of completion (Bu: of the 21,600 supreme unchanging moments) in which all Tathiigatas obtain highest, perfect Buddhahood, all phenomena do not originate, do not abide and do not disintegrate, for they are unconnected (niranvaya). Another quotation from VP 1.5, a commentary on KCT I: 1: eval!' paramilrthasattabhilvild ekakeG/Jo nilsti ekilnekavirodhild iti ! iha yad ekakealJilbhisambuddhal; sarvakealJavibhilvaka851 iti tat prathamal!' paramilkearasukhakealJilbhisambuddhal; san ekarvil!'satisahasra,atsataparamilk,arasukhak,alJabhilvakal; /852

Thus, "since absolute being does not exist, there is no single moment because one and many are contradictory." Here, regarding that "highest, perfect Buddhahood in one moment the person developing all the moments": is the first, highest, perfect Buddhahood by means of a moment of supreme unchanging bliss for the person developing the 21,600 moments of supreme unchanging bliss. Here allusion is made to 21,600 moments of the supreme unchanging bliss. This can seem strange but it is a way of describing the passing of these moments through the central channel (avadhiiti) in the body. There is also a stress on the fact that the supreme unchanging bliss exists at one moment, but at many consecutive moments. This kind of reasoning perhaps approaches the concept of instantaneous illumination which exists in the Chinese Cha'n Buddhism. The highest, perfect Buddhahood is reached in one moment. There is an interesting annotation by Bu-ston to a quotation from the Manjusrf-niimasangfti. 853 There he states that the supreme unchanging is the same as that all matured beings have a single taste. The Vimalaprabhii commentary to KCT V: 127 gives a word by word commentary on the first ten pages and then continues with a long discussion of this and other related subjects. The 114 pages do not only treat the unchanging but also other subjects. I have drawn from the text all the passages where the word paramiik~ara (the supreme unchanging) is to be found. I have translated the surrounding text and finally an analysed the content. In order to understand the following chapter on the supreme unchanging and verse KCT V:127, it is necessary to study KCT V:126 which treats the very important concept of bindu. The verse KCT V: 126 is the last verse of the second subchapter in the the fifth chapter of the KCT and the VP. That chapter is the one that treats the four bodies of the Buddha that I have previously treated in chapter five. Verse 126 is a bridge to subchapter three. Here follows KCT V:126:

'51 This is a quotation from the MNS 141cb (Davidson 1981:35) and MNS VIII:23bc in Wayman. 1985:106 and Davidson. 1981:21. 852 Vimalaprabhii 1.5 in VP YoU. 1986:44, line 23-25. Newman. 1987a:375. 853 VP VoL!. 1986:58, line 23-24. Newman. 1987a:441-442. Bu-ston. 1965a:435, line 2-6.

173

evaTfl cittaTfl caturdhii trividhabhavagataTfl priil;liniiTfl bindumadhye yogfndrai ralqal;liyaTfl samasukhaphaladaTfl vyiipakaTfl mok~aheto/:l I bindor molqe leva mok~o gataparamasukhe yoginiiTfl janmabije tasmiit saTflSiirasaukhyak~al;la iha yatibhi/:l sarvadii vatjaniya/:l II 126 11 854 In this way, as for the fourfold mind (citta), residing in the three existences, and residing in the middle of the bindu of the sentient beings; by the skiUed yogins the 855 [bindu (semen)] is to be protected and provide the fruit of equal bliss, the aU-pervasive, for the purpose of liberation. In the bindu's liberation [emission], where is the liberation. It is in the birth-seed (bija) ofthe yogis who have lost the supreme bliss; Therefore, for this reason, the moment of bliss in saTflSiira is always to be shunned by the ascetics.

In this verse bindu is introduced in the current context. It seems to mean the male semen, although it also seems that the bindu is contended in the bija (seed) of the yogin. Consequently, bindu is the drop in the semen. In the bindu is the citta. All this is also a "hidden language" which has other connotations, as will be seen in the commentaries.

6.1.1. The third subchapter of chapter V: Paramii~ara-jiiiina-siddhi­ The perfection of knowledge of the supreme unchanging.

Tibetan: mChog-tu mi-'gyur-ba'i ye-shes grub-pa shes-bya-ba'i mdor-bsdus chen_po.856 This subchapter treats verse KCT V:127 and the Vimalaprabhii co=entary. The Sanskrit text is found on p.60-103 in the Indian edition from 1994. 857 These pages have been searched in order to find a clue to understand the concept of paramiilqara, the supreme unchanging and all the passages containing the word paramiik~ara have been translated. KCTV:127: Sanskrit text of the verse:

ekatvaTfl hy iidikiidyo/:l sasidinakarayor iisanQT{l vajril;lo na huT{lkiirel;laiva cihnaTfl paril;latam aparaTfl ne~yate varl;larilpaTfl I utpannasyiilqarel;la lqaranidhanagatasyiisya divyendriyasya sarviikiirasya bindo/:l paramajinapater vifvamiiyiidharaSya 1/127 11 858

854 Banetjee. 1985:230 and Vimalaprabhii V.2 in VP VoI.ID. 1994:59. •" Banetjee has bhogindrai but this reading from VP seems more correct. 856 The key concept of this chapter evidently is paramalqara(-sukha) which I translate as the "supreme unchanging or the "supreme unchanging bliss", depending on the context Hartzell (Hartzell. 1997:1254) translates it as the supremely indestructible" or the supremely indestructible bliss". I still opt for the translation "the supreme unchanging" "because of the context and connection with the Adibuddha concept "Unchanging" better translates the connection with time. Another translation for alqara is "imperishable". 8S7 VP YoU. 1986:60-103. ". Banetjee. 1985:231 and Vimalaprabhii V.3 (chapter V, subchapter 3) in VP VoUIT. 1994:60, line 7-10.

174

Tibetan: gang phyir a sogs ka sogs ri bong can dang nyin byed gc.ig nyid rdo Ije can gyi gdan min zhing I Hum yig nyid leyi:;s mtshan ma dang ni yongs su gyur pa gzhan pa kha dog gzugs dag mi 'dod de I 'gyur med dag gis bsleyed cing 'gyur ba nyams par gyur pa mchog gi dbang po dang ldan pa ni I rnam pa kun ldan thig Ie mtha' dag rgyal ba' bdag po snatshogssgyuma 'dzinpa 'dila'oll'" Therefore, because of the unity between vowels and consonants, that is, the unity of the moon and the sun, there is no seat (iisana) of the vajrin. The sign is completely transformed by the syllable Hillr1, the other [sign] is not desired as a form ofthe syllable. [The sign of] that which is produced by the unchanging, [of that] which is in the perishable receptacle, [of that] which is the divine sense, and [of that] which is the bindu which has created all aspects, [of he who is] the supreme master ofjinas and [who is] the carrier of all illusions. This verse is difficult. What is meant by the word vajrin? From other places in the text, the following can be derived: In KCT II:161, vajrin means the Buddha Siikyamuni 860 . In II:48 and following, it is the Raudracakrin who is going to fight the mlecchas in the fmal war as king ofShambhala. 861 In II:53, it is thejinapati "master ofthejinas,,862 and in II:92, vajrin is khavajrin (sky-vajrin), which is pure consciousness and in the end sunyatii (the Void2.863 In KCT IV:1, vajrin is equated to Kiilacakra according to the adjoining commentary.8 4 In this context, one could probably think of vajrin as that which is beyond the sahajakiiya, that is, "Adibuddha". The Vimalaprabhii commentary to KCT V:127:

nama!; Jrivajrasattviiya I namo mahiimudriiyai param~arasukhiiya I namo gurubuddhabodhisattvebhya!; I nama!; krodhariijavajra¢iikavajratjiikinfbhya!; I idiinfm alqarodbhavasahajakiiyasyiilikiilipadmacandrad ity iisanahurrzkiirapariTJatacihnotpiidarupavarTJabhujasa1!lSthiinaparikalpaniidharmaprativedho hi yasmiit tasmiid bhagavata!; paramiilqarajiiiinasiddhir ucyate (Here the earlier translated verse KCT V:127 is quoted).

ekatvam ity iidinii I ekatvaTf1 hy iidikiidyor iti I iidir akiiradisvarasamuho hakiirai candra!; pratyeka1!l svaras ca I kakiiriidir vyaiijanasamuha!; lqakiira!; surya!; pratyekaTf1 vyaiijanaTf1 ca I tayor iidikiidyo!; saJidinakarayor hakiiralqakiirayor vii I akiirapakiirayor ekatvam eklkaraTJam iisanam adhiira!; I pakiiravyaiijaniitmaka'!! padmam I akiiriitmatmakaTf1 candra'" Bu-ston. 1965c:Part 3, p.lOI Vimalaprabhii II.7 in VP Vol.I. 1986:255; translated in Wallace. 1995:428.

860

'6' Vimalaprabhii II.3 in VP YoU. 1986:183-184; translated in Wallace. 1995:220. Vimalaprabhii Il.3 in VP Vol.I. 1986:186, line"23 to p.l87, line 5; Translated in Wallace. 1995:230. Vimalaprabhii II.S in VP YoU. 1986:219, line 17-28; Translated in Wanace. 1995:329. '64 Vimalaprabhii N.I in VP Vol. II. 1994:149, line 24 -p.lSO, line 8. '62 '63

175

maTJ4ala~ hakaratmaka~ va rephatmaka~ silrya1!laTJ4ala~ k~akaratmaka~ va / adheyasya vajriIJal;t vqjram abhedyasya paramak~arasllkhasya jnanam acyuta1!l tad asminn astfti vajri tasya vajriIJa adheyasya / ••,

Translation with Bu-ston's commentaries within brackets. I will here use Bu-ston's commentaries in order to clarify some points: (skt. VP p.60:I; tib.Bu: p.lOI:3) Homage to Sri Vajra [Bu: by examining the wisdom of the fruit, the grasped and that which grasps and the non-duaI, because they are inseparable] sattva [Bu: because the three existences became into one essence] [Bu:These two became inseparable]. Homage to Mahamildra, [Bu: The way and prajna , the parts were like the brilliance of a mirror gone beyond the dharma-essence of the indivisible particles, they became the complete void (viSva-silnyata)] the supreme unchanging bliss [Bu:[which is] the great bliss which has stopped the defilements which flow out of a man from the upaya void-body (silnyata-bimba)]. Homage to the gurus, the Buddhas and the bodhisattvas [Bu: who teaches that]. Homage to the Krodharajas, the Vqjra¢akas and the Vajra¢akinfs. (VP p.60:4) Now, therefore. Therefore, from the sahajakiiya produced from that which is unchanging"', there is a perceiving of the dharmas that assume the form of syllables situated on the arms, etc. and [fonns] coming from the transfonning sign of the hil1!lkiira on the vowels and consonants ofthe moon and sun places of residence; Because this is the case, the Bhagavan 's perfection of (paramiilqara-jnana-siddhl) knowledge of the supreme unchanging is described. (Here, the verse V: 127 translated on the fore-going page is quoted in the commentary). (VP p.60:1l) As for the "unity", etc., because there is the unity of the vowels and consonants. As for A-etc., (Bu: the vowels) they are the set of vowels with the letter A, etc. The HA-Ietter is the moon and individually it is a vowel. The KA-letter etc [the consonants] is the assembly of consonants; and the K~A-Ietter is the sun and individually it is also a consonant. These vowels and consonants, the mOQn and the sun are the HA-Ietter and the K~A-Ietter. There is unity of the A-letter and the PA-letter, the unifying seat (asana) is the basis. The manifested essence ofthe consonant PA is the lotus. The lunar maTJ4ala has the essence of the A-letter or the HA-Ietter. The solar maIJ¢ala has the essence of the RA or the essence of the K~A-Ietter. Ofthe one designated, ofthe vajrin, the vqjra of the indivisible one is the non-transmigrated [or: imperishable?] (tib. mi- 'pho-ba; skt. acyuta) knowledge of the supreme unchanging bliss. That is in him, therefore he is a vajrin and is referred to as vajriIJa (skt. VP: p.60:16; tib. Bu: p.I02:4).

86' Skt.: Vimalaprabhii V.3 in VP Vol.lII. 1994:60, line 1-16. Tib.: Bu-ston. 1965c:l0l, line3-p.102, line 4 . Here it is interesting to compare with KCT V:89 and the whole subchapter on the four bodies vv.89-124. There it is written that sahqjakiiya is drawn out from the Adibuddha. Here, it has originated from the unchanging. Consequently, Adibuddha corresponds to the unchanging if a comparison is made. ••6

176

Here, the supreme unchanging has various connotations. First, the author pays reverence to the supreme unchanging bliss (paramii~arasukha) in the same way that he pays reverence to Buddhas, gurus, krodhariijas, etc., and compares the concept with the concept of Mahiimudrii. Then it is mentioned that sahajakliya has its origin in the unchanging (a~ara). This is another indication of the theory that the sahajakliya is a level of existence which is secondary to the level of unchanging, or supreme unchanging. The wisdom of the supreme unchanging is then referred to as being at the origin of the alphabet. This has some logic, because jniina -wisdomlknowledge is more the intellectual side of wisdom. Also, of course, because paramii~ara can be translated as "the supreme syllable". The last mention of the supreme unchanging in this part of the text is when it is referred to as the wisdom of the supreme unchanging bliss which is imperishable (acyuta). Here again, the word acyuta is an important word for the understanding of the text. It refers to the word acyuta (tib. mi- 'pho-ba), which can be inteIpreted in different ways. The actual meaning of the word is "not fallen", but another meaning is "imperishable, permanent, firm".867 The normal translation of the word 'pho-ba from Tibetan into Sanskrit seems to be sa7(lkriinti or sa7(lciira 868 and the meaning of 'pho-ba is "to change place, migrate". The translation of mi- 'pho-ba as acyuta is not found in the dictionaries, except in one place in the Mahiivyutpatti where it is used in the very interesting expression: "acyutiinutpannii!J sarvadharmii!J", in Tibetan "chos thams-cad-ni 'chi 'pho-ba-med cing ma skyes-pa", which could be translated as "all the dharmas are not produced and do not die (are not transmigrated)". This quotation is found in the chapter on the thirty-two great compassions of the Tathiigata and is one of the thirty-two 869. If, in this context dharmas signifies the small dharma-particles, it means that the dharmas are the same through different lives. This is approaching the concept of mi- 'pho-balacyuta in these texts. The usual meaning of acyuta, though, is "imperishable, permanent". ill the Das dictionary a quotation of interest in this context is found: Kiilacakra is "'phomed thog-ma tha-ma-med", translated as "there is no migration and there is no beginning and no end".870 This line of thought is similar to the expression in the modem Tibetan commentary on the Kiilacakra by Geshe"Ngawang Dhargyey that there is something indestructible that lives on from life to life. 871 Consequently, there is no real rebirth. Here, the meaning is perhaps that the supreme unchanging is that which is born again in another body. This line of thinking comes close to the traditional illdian concept of iitman, but it is difficult to draw any definitive conclusions. Perhaps there is a Tibetan tradition of inteIpretation of the word acyuta as mi- 'pho-ba, thereby connected to the well-known Tibetan •., See Monier-Williams. 1976(1899):9 . ... Das. 1976 (1903), p.849. The meaning of sa",kranti is "going from one place to another, transference to" (Monier-Williams. 1976(1899): II27 . .., Mahiivyutpatti 1972, Part I, nr.166, p.l3 . • 70 This quotation is found in Das. p.849. It is, according to Das, taken from the text mNgon-brjod mkhas-pa'i rna-rgyan, a Lhasa blockprint in 80 leaves by Ngag-dbang Jig-rten dbang phyug grags-pa 'i rdo-rje from Saskya Pa{l-chen's text Tshig-gter, which is a Tibetan translation of Amarko~a and other lexicons. I have searched for this text to the present, without result. In the Tshig-gter and the Amarko~a, I have found nothing of interest. .71 Dhargyey. 1985:91.

177

practice of 'pho-ba, "consciousness transference", which is one of the six yogas of Nii-ropa. In the following passages the word acyutai mi- 'pho-ba is used several times and will be commented upon. The commentary on KCT V:127 continues (p.63; p.ll0) with commentaries to the text word by word. In continuation, translation and comment will only concern the parts of the commentary that treat the concept ofparamii./qara, that is, the supreme unchanging. A continuation of the commentary to KCT V: 127 follows:

paramiirthataf:t svaravyaiijanasamiiho '/qaro na bhavati I a/qarasabdena872 paramiik~arasukha". jiiiina". vajrasattva iti I tathii manastriilJabhatatviin mantro 'pi paramiilqarajiiiinam ucyate I 873 (VP 60:22; Bu 103:2) Neither the vowel nor the consonant group is unchanging from [the side of] ultimate reality (paramiirtha). By the word unchanging [is meant] the lmowledge that is the supreme unchanging bliss (paramii/qarasukha".jiiiina".), the Vajrasattva. Accordingly, since it has the purpose of protecting, the mind (manas), [and] the mantra are called the supreme unchanging wisdom (paramii/qarcifiiiinam).

(line 25) sahajatanur ity ucyate jinaif:t I (VP 60:27; Bu 103 :4) paramiilqarasukhasvabhiivau paramiilJudharmatiitftau iidarsapratiseniisvapnatulyau paramiik~arasvariipiiv iti I atriik~ariilJfti riipavedaniisa".jiiiisaf!lSkiiravijiiiini niriivaralJiini paiicii/qariilJi mahasanyiiny uktiini I tathii prthvyaptejoviiyviikiisadhiitavo niriivaralJiif:t (VP p.61 :1) paiiciik~ariilJY uktiinfti I ~a4a/qariilJi cak~uf:t srotraghniilJcifihviikiiyamaniif!lSi niriivaralJiini pratyekasvasvavi~aya­ grahalJavarjitiini I tathii riipasabdagandharasasparsadharmadhiitavo niriivaralJiis ca (vp p.61 :3) ~a4lqariilJY uktiinfti I etiini skandhadhiitviiyataniiny ekasamarasfbhatiini bindusUnyo bhavati I sa ca bindur acyutaf:t san paramii/qara ucyate I pa;'amiik~aro 'pyakiiro 'kiirasa".bhavaf:t samyaksa".buddhaf:t prajiiopiiyiitmako vajrasattvo napuf!lSakapada". sahajakiiya ucyate jiiiinajiieyiitmakaf:t hetuphalayor abhedyatviit I sa ca kiilacakro bhagaviin paramiik~arasukhapadam ity ukta". bhagavatii niimasangftyii". vajradhiitumahiimalJ4alastave prathamaslokena (vp p.61 :7) tadyathii bhagaviin buddhaf:t sa".buddho 'kiirasa".bhavaf:t I akiiraf:t sarvavarlJiigryo mahiirthaf:t paramiilqaraf:t 874 11 875 (VP p.60:25; Bu p.103:4) As for sahajatanu, it is described by the jinas ...

(VP p.60:27) .. the two [Vcifrasattva and BuddhamiitrJ who both have the B72 The translation of this word poses some difficulty. Alqara could mean "imperishable, unalterable or unchanging", but also "letter, syllable" (Monier-Williams 1976(1899):3). Here, it would seem logical to trall.slate it as "syllable", but the meaning of the word in this context could also be "imperishable, unchangeable". The underlying meaning of the concept is very similar in both cases. 873 Skt. Vimalaprabhii V.3 in VP Vol.IIl. 1994:60,line 22; Tib. Bu-ston. 1965c:103, line 2 874 The last two lines are quotations from the from the text MaFijutri-niima-sangiti (MNS) Chapter 5,. verse I; Verse 28 in Davidson's edition. See text and translation in Wayman. 1985:68 and Davidson. 1981:22 and 51. 87S Skt. Vimalaprabhii V.3 in VP Vol.I1I. 1994:60, line 25, 27- p.61, line 9; tib. Bu-ston. 1965c:103, line 4104, line 4

178

supreme unchanging bliss as their own nature, both have transcended the nature of indivisible particles (paramtilJu), both are like a dream and a divination (pratisena), both have the proper form of the supreme unchanging. Here are the unchangings (ak:;ara), they are the five unchangings: form (riipa), sensation (vedanti), perception (sarr 876 Skt. niriivara(la, tib. sgrib-pa med-pa. This word poses some problems. I have translated it as "without obscurities" refering to a special state of these concepts when they are completely pure. This interpretation is also based on the Tibetan translation which makes a point in translating the word iivara(la with the word sgrih-pa which is translated as obscuration or something similar. Hartzell translates these passages as "unveiled" which is perhaps the easiest translation, looking at the word purely linguistically (Hartzell. 1997:1257) but the Tibetan translation does not have this meaning. See also Edgerton 1972(1953):107 in the Buddhist Hybrid Sanskrit Dictionary where he states that iivara(la is (darkness, obscuration) standardly rendered with sgrih-pa in Tibetan. 877 See the discussion on mi- 'pho-ba and acyuta above (p.l77). Here an interpretation of acyuta both as imperishable and non-transmigration is possible from the context. The less controversible translation is "imperishable". 878 I have used the translations of Wayman. 1985:68 and Davidson. 1981:22 and consequently from the context translated the word paramiik1ara with "the supreme syllable". It is interesting to note this other meaning

of the word and that it does not necessarily mean "the supreme unchanging". In the context of this quotation

from the 5th chapter of the Vimalaprabhii, it is obviously there in order to legitimize the reasoning with the letters of the alphabet. Akfara means both "imperishable, unchanging" and "syllable". The author of the text wants to point to the fact that the word was used in the, for the tradition very valuable, text MNS and in the figurative sense, even in the MNS, the word is used for something original, the letter A. The Buddha also has his origin in that letter, or in another meaning, from the "supreme unchanging" (Wayman. 1985:68). Wayman comments in the following way: "in Chapter IV, A is the first of the twelve stages. "Accordingly", all ofthose in higher stages and in the Buddha stage can be said to have "arisen from A".

179

Here an analysis of the relationship between the translation of paramak.,ara as "the supreme syllable" and the translation as "the supreme unchanging" is presented. The imperishable bindu is called supreme unchanging. This bindu could possibly be seen as part of the Adibuddha concept. There is also a discussion of the different types of unchangings (or indestructibles). They are the five skandhas, the senses, etc., without obscurities. They are the normal phenomena, but purified in some way. The supreme unchanging is the a-letter/sound Which consists of prajiia and upaya and also Vajrasattva and Sahajakaya and other correspondances. The sound ofthe vowel A is in the beginning which makes it the principle of origin. The commentary continues with mention of the "unchanging" and the "supreme unchanging": tatha miilatantre 'py uktam tad yatha iidiklidisamayogo vajrasattvasya vi~{ara/;l I ak~arodbhavakliyasya hUl'{lkliradyal'{l na ceiYate II '79

(VP p.61:l5; Bu p.I04:7) Accordingly, in the root-tantra it is stated as: "the union of the vowels and the consonants is . the sacrificial seat (vi~{ara) of Vajrasattva, and the letter HUl\1, etc., is not accepted as the body arisen from the unchanging (alqara)." sa paramak~aro 'cyutalqalJU/;I klila ity. abhidhfyate I tad eva vajrajiianam iti I tasya klilasya niriivarat;lUl'flskandhadhatvayatanal'{l cakral'{l tribhavasyaikatvaTfl niravarat;lal'{l jiieyam iti I tad eva vajradhatumahamat;lrJalam ity ucyate sarvlikliral'{lsarvendriyal'{l binduriipaTfl visvamayadharaTfl 88.

(VP p.61:l9; Bu p.I05:2) The supreme unchanging is the imperishable (not transmigrated) (tib. mi- 'pho-ba; skt. acyuta) 881moment; it is designated as time (skt. klila; tib. dUII).'82 The essence of this is vajra-knowledge (jiiana). The unveiling of that time (Bu: the supreme unchanging), is the cakra, [that is], skimdhas, dhiitus and ayatanas (p.105 :3); and the unity of the unobscured three worlds is knowable. As for the essence of that, it is called the great mat;l¢ala of Vajradhatu. It is of universal form, of all the sense-organs, ofthe bindu-form, sustaining the universal illusion. Here, the concept of paramalqara is designated both as the moment of being imperishable and as time (kala). Here is also explained how the concept of "supreme unchanging" is actually time. A philosophy of time is inherent in the Kalacakra Tantra and here it is actually expressed. "Time" can be seen as being unchanging.

'7, Vimalaprabhii V.3 in VP Vol.III. 1994 p.61:15-17; 88. Vimalaprabhii V.3 in VP Vo1.III. 1994 p.61:19-21;

Bu-ston. 1965c:104, line 7. Bu-ston. 1965c:105, line 2-3. 881 Here again is the word acyula which, in this context, actually could be interpreted as the "nontransmigrated". 882 The Sanskrit original text here gives a simple kala (time), while the Tibetan has dus-shes, which in this case is only the translation of sk!. iii.

180

The "supreme unchanging knowledge" has consumed all obscurations and, as can be seen from other places in this text, these unobscured skandhas, etc., are unchanging. The supreme unchanging is also designated as imperishable (or not transmigrated) moment. That moment is consequently beyond· everything transcended. It is also designated as "time", which means that time is in some way at the origin of all things in the worlds. This was already stated clearly in the fourth verse of the KCT (see above, p.79). The VP commentary on KCT V: 127 continues: puna~

sa eva kiilacakro bhagaviin prajfiopiiyiitmako jfieyajfiiinasambandhenokla~ I alra paramiik!farajfiiinartt sarviivaralJak!fayahelubhiilartt kala ity ukla upiiya~ I jiieyaJ!I Iraidhiitukam ananlabhiivalak!fa/Jartt cakram tad eva prajfiii I jfiiinajfieyayor ekatvartt kiilacakram iti I 883

VI> p.62:7; Bu p.l06:3) Once again, he alone is Bhagaviin Kiilacakra who consists of the very essence ofprajiiii (wisdom) and upiiya (method) described by the relationship of what is to be known (jfieya) and knowledge (jfiiina). (p.l 06:4) Here the supreme unchanging knowledge (jiiiina) becomes the cause which consumes all obscurations. The method (upiiya) is described as time (kala). That which is to be known (jiieya) consists of the three realms, characterized by unlimited existence, the cakra (wheel), That indeed is wisdom (prqjiiii), The unity of knowledge (jfiiina} and that which is to be known (jiieya) is called Kiilacakra, Here it is stressed that Kiilacakra is the union/essence of prajfiii and upiiya, which is classical madhyiimika philosophy, Kiilacakra is also the union of jfiiina (knowledge, gnosis) and jfieya (the knowable), Upiiya is also described as "time" and prajfiii is described as cakra, kalasya jiiiinariipasya jfieyalak!falJartt cakram anayor jfiiinajfieyayor ekatvartt kalacakram iti I anenoktakramelJa sa eva kalacakro bhagaviin evarttkiiro vajrasattva~ sarvatantre!fu sarttg1lo jinai~ I uktartt bhagavatii miilalantre paficame parale abhedyartt sarvato jfiiinartt vajram ity abhidhfyate I tribhavasyaikatii sattvo vajrasattva iti smrlal; II lasmiid asyiik!farotpannasya sarviikarasya bindo~ sahajakayasya sakalajinapater visvamiiyiidharasyiidhiiriidheyasambandho ne!fyate mahiimudriisiddhyartham I yathii laukikasiddhisiidhaniirtham iidhiiriidheyasambandha i!fyate talhii paramiik!farasukhasiidhaniibhiratena yoginii 884

(VP p,62:16; Bu pJ07:1) The cakra oftime (kala), that has this form of knowledge (jfiiina) (Bu: the knowledge of the supreme unchanging bliss), [it has] the characteristics ofthat which is to be known Ufieya), The unity of these two,jfiiina andjfieya, is Kiilacakra, (p.l07:2) By this sequence of statements, the very essence of Bhagaviin Kiilacakra and the letters: E (Bu: jfieya) YAM (Bu: jfiiina) is Vajrasattva, and by thejinas it is praised in all the tantras, 883 Yimalaprabhii V.3 in VP VoLIIL 1994:62, line 7; Bu-ston, 1965c:l06, line 3-4, 884Yimalaprabhli V,3 in VP VoLIn, 1994:62, line 16-23; Bu-ston, 1965c:l07,line 1-5,

181

By the Bhagaviin, it was stated from the fifth chapter ofllie root-tantra: "- The knowledge (jiliina) 885 that is in every way indivisible is designated as vqjra.(p.107:3) - The living being that is the unity ofthe three worlds is known as Vajrasattva." Therefore, from the bindu of universal form that arises from the unchanging, from the sahajakiiya ofthe master ofjinas (jinapatl), who is the support (adhiira) of universal illusion (mayii), the relationship of the support and the supported is not considered as for the sake of the perfection ofthe mahiimudrii. Since for the sake of the practice ofthe worldly siddhis, a relationship of the support and the supported is accepted (VP p.62:23; Bu p.107:5), therefore, for the yogin who rejoices greatly in the practice of the supreme unchanging bliss, [such a relationship] is not accepted. Here is a quotation from the unknown root-tantra where it is stated that the sahajakiiya is arisen from the bindu and, in consequence, from the unchanging. This state of the "un~ changing" corresponds actually to the Adibuddha concept. It can be noticed that the supreme unchanging bliss also is a state that can be achieved by someone who practises the ~at!aflgayoga.

An important analysis of the word Kalacakra is also given (See above, p.80 for a commentary on that word). Kiilacakra is analysed as knowledge and the knowable, and knowledge (ji'iiina) is by Bu-ston described as "the knowledge of the supreme unchanging bliss". Consequently,ji'iiina in this context has a special meaning as being connected with the concept of the "supreme unchanging" and the bliss resulting from this. prajilopiiyiitmakena bodhicittasthirikaralJaikadalqelJa paramalqaramahiisukhaprajiliijiliinamiirgopaddalabdhena iidhiiriidheyacihnavarlJabhujasaTflSthiinamalJtfaladevatiiparikalpaniidharmo ne~ate 886 iti / 881 (VP p.63:3; Bu p.108:4) .... by [the one who, i.e. the yogi,] consists of the essence of prqjnii and upiiya, for whom one moment establishes the bodhicitta, who has obtained the instruction of the way of prajiliijiliina (wisdom and knowledge) [that leads to] the supreme unchanging great bliss; the dharma property of the deity of the mawala who is established in the shape, colour and arm by means of the syllables as the characteristics of the support and the supported. Here, once more it is mentioned that the way/union of praji'iii and upiiya leads to the supreme unchanging great bliss. This state is possible to be reached by a trained yogin.

iha riiga utpiidakiilafJ cyutir nirodhakiilafJ tayofJ samiipattir alqarakiilafJ 888

885

886 881 888

jiiiina (skt) =ye-shes (lib.). Bu-ston slales thaly. is the bliss of the supreme unchanging. Although in the VP il is written ne~ata, because of sandhi-rules, 1 here interpret it as ne~ate.

Yimalaprabhii Y.3 in YP Yo1.1I1. 1994:63, line 3; Bu-ston. 1965c:108, line 4. Yimalaprabhii Y.3 in YP Yol.lIl. 1994:75, line 20; Bu-ston. 1965c:145, line 2.

182

(VP p.75:20; Bu p.l45:2) Here passion is the time of birth and the perishable/ejaculation (cyulir, tib. 'pho-ba) is the time of death; the meeting of the two is the unchanging time.

Here passion and the perishable/ejaCUlation meet and create unchanging time. EjaCUlation as death could be an allusion to the sexual yoga in the Kalacakra, which implies that it is absolutely forbidden to ej aculate in the yoga in order to reach the goal of liberation.

evam ubhayoJ:! pratyekajiiiine satyadvayajiiiiniibhiivaJ:! advayajiiiiniibhiiviid buddhatvasyiipy abhavo bhavati visuddhaparamiik~arajiiiinarahilatvad iii I atha prajiiiiyii jiiiinarr< prajiiiijiiiinarr< yadi tadii upiiyasya jiiiinarr< upiiyajiiiinam iii evarr< purvavad do~a iti I uktm[1 bhagavatii niimasangftyiirr< pratyavek~a1Ja­ jiiiinastave ~attrirr 8" These two verses, 34-35, (Davidson 110-111) are from the Maiijusri-nama-sangfti. For the text and the translation, see Wayman. 1985:96 and Davidson.198 I :57 and 32. 89' Vimalaprabha V.3 in VP VoI.IlI. 1994:79, line 30-80, line 3; Bu-ston. 1965c:157, line 7-158, line I. 8" pratyavek~al;lii is one of the five kinds ofjiiana. "reflection", see Edgerton 1972 (1953):376. 89' Translated by Wayman. 1985:96 and Davidson. 1981 :32.

183

preted in the same way in more places. The essential meaning of the two meanings of the word is similar. A is the first, and in that way also the supreme syllable. The other meaning as "the supreme unchanging" or "the unchanging of the supreme" can be compared to the concept of Adibuddha, which also means "the first (original) Buddha". This can be compared to the first syllable A. It should be noted that the Tibetan almost exlusively use the expression mchog-tu mi- 'gyur-ba for the word paramiik~ara, even when it, in Sanskrit, can be interpreted as "the supreme syllable". At some places the Tibetan uses yi-ge-mchog. It is also mentioned that the paramiik~ara-jiiiina has already been described in the Niimasanglti. The individual knowledge is not the completely pure knowledge of the supreme unchanging, but this knowledge is found in the Niima-sanglti. This could have some relation with that the fourth body of the Buddha sometimes being called the Suddhakiiya (the pure body). Below follows a quotation from the root-tantra on paramiik~ara: mulatantre 'pyuktamkarmamudriilJ' parityajya jiiiinamudriilJ' vikalpitiim I paramiik~arayagena mahiimudriilJ' vibhiivayet II ata bhagavata niyamiit karmamudriisukhalJ' samantabhadraparamiik~ar­ asukhalJ' na bhavati tathii ma/,¢alacakrabhiivaniivikalpitaprajiiiisukhalJ' samantabhadralJ' paramiik~arasukhalJ' na bhavati 893 (VP p.80:19; Bu p.159:1) In the root-tantra it is also said: "Having abandoned the karmamudrii and the mentally constructed jiiiinamudrii, by union with the supreme unchanging, one should produce the mahiimudrii." Therefore, from what has been established by the Bhagaviin, the bliss ofthe karmamudrii is not the bliss afthe completely good (samantabhadra)894 supreme unchanging (p.159:2). Accordingly, as for the bliss of prajiiii, which has been mentally created by meditation on the mal;l¢ala-cakra, it is not the completely good (samantabhadra) supreme unchanging great bliss.

Here, the fact that the union with the supreme unchanging produces the mahiimudrii is mentioned. This could be a designation for the ultimate state that can be reached by the yoga in the Kiilacakra Tantra, the yoga of six limbs. I have previously treated the problem with the 21,600 moments of supreme unchanging. It is connected with the teaching that in the central channel in the body, the avadhati, there are piles of bindus which are moments of supreme unchanging bliss. Samantabhadra is one of the most important bodhisattvas. He could also be an Adibuddha as in the Tibetan school of rNying_ma-pa,895 however Samantabhadra could also simply mean something very good. nanu yadi samantabhadralJ' paramiik~arasukham tad eva caturthalJ' mahiimudriijiiiinalJ' mahiimudriirahitalJ' na bhavati I 896

Vimalaprabhii V.3 in VP Vol.lII. 1994:80, line 19; Bu-ston. 1965c:159, line 1-2. The word samantabhadra is used here. It is possible that it could also mean the Samantabhadra as the lidibuddha-figure in the rNying-ma-pa school. Such an interpretation is interesting but perhaps not credible. Hartzell translates this as "the completely good" (Hartzell. 1997:1323). 895 Schumann. 1986:109. 893

894

184

(VP p.80:28; Bu p.I59:5) In case of [that there is] just the completely good (samantabhadra) supreme unchanging bliss, that very fourth, the knowledge of mahiimudrii, does not exist without the mahiimudrii. iha sattvii yena riigelJa eyutena pralaya". maralJam upagataIJ tenaiviieyutena patiiyino buddhii muktii bhavanti I '"

ramiik~arabhiitena

VP p.8I:8; Bu p.I60:3) In this sense, living beings who [otherwise] have gone to dissolution at death, that is, reached the final destruction, by means of that fallen (ejaculated) passion; they can become liberated Buddhas, saviours, by means of the non-fallen [non-ejaculated passion] that becomes the supreme unchanging. Here again, allusion is made to the sexual yoga and it is stressed that in practising the nonejaculated passion one can become the supreme unchanging, and, in consequence, a liberated Buddha. eva". yogino 'pi paramiik~arasukhiibhyiisava§iid hiihyaeyutisukhaparityiigiit kumiirikiivasthiintaragatii ato tiiniigatavartamiina". pa§yanti 8"

(VP p.88:27; Bu p.I80:2) Accordingly, the yogins, through the influence of practising the bliss of the supreme unchanging, and through the abandonment of the bliss of falling in the outer (external ejaculation), enter a virginal state'" and see the past, future and present. Once more it is mentioned that the yogin can do a practice called "the supreme unchanging bliss." The sexual yoga is here quite explicitly explained. The abandonment of ejaculation leads to the supreme unchanging bliss. 900 The practitioner of the sexual yoga of Kiilacakra consequently can see into the past and into the future, in that way transcending time (kala). This is one of the characteristics of the time philosophy contained in the Kiilacakra Tantra. nanu paramiik~arasukhiibhyiisa". vinii 'brahmaeiirilJo 'py aneke kaivalya". de§ayanti tasmiid brahmiieiirya". vinii mantradevatiidhi~thiina". bhavati /,01

(VP p.88:30; Bu p.I80:3) Objection [of opponent], without exercising the bliss of the supreme unchanging, there are also many non-brahmiieiirins who teach about absolute unity (kaivalya; isolation); therefore, without [being] a brahmiieiirin there may still be the empowerment of the mantra deity. Again the bliss of the supreme unchanging is something that is practised and leads the way to absolute unity (isolation, kaivalya). This expression is rare in the Kiilacakra texts. It "6 Vimalaprabhii V.3 in VP VoLII!. 1994:80, line 28. Bu-ston. 1965c:159, line 5. ,,, Vimalaprabha V.3 in VP Vol.III. ]994:81, line 8; Bu-ston. ]965c:160, line 3. go, Vimalaprabhil V.3 in VP VoLli!. 1994:88, line 27; Bu-ston. ]965c:180, line 2. "9 This refers to a divinaton simile. 900 The sexual yoga in the Kalacakra Tanlra has been extensively treated in Hartzell. 1997:910-932. 901 Vimalaprabha V.3 in VP VoLII!. 1994:88, line 30; Bu-ston. 1965:]80, line 3.

185

seems like it is more a way of expressing the classical manner of absolute or final liberation? This word, isolation, is used in the classical yoga-satras of Patanjali. By this practice it is probably meant the practice of sexual yoga. eval[l sarve keudramantradevatii 'dhiefhiinakramii miiriil}iil[l paramiikearajniiniibhiratair yogibhir viciiranfyiil} / ebhil} ksudramantrtidhisrhiinair vajriiveso na bhavati /'02

(VP p. 89:32; Bu p.183 :2) In this way, aH of them, having k sudramantra-deities'03 foHowing the authority of the Miiras, are going to be discerned by these yogins who take pleasure in the knowledge of the supreme unchanging. By these ones established by the ksudramantras, there is no taking possession ofthe vajra.

Here is mentioned that the yogins take pleasure in the knowledge of the supreme unchanging. atal} sattvopakiiral} pWJyasa1!lbhiiriirtha1!l kartavyal} jniinasambhiiriirthal[l paramiiksarajniinabhiivanii kartavyii / sattviirtha1!l vinii pUlJyasambhiiro na bhavati paramiiksarajniinabhiivanayii vinii jnanasambhiira§ ceti tathagatahrdayam /904

(VP p.90:24; Bu p.184:7) Therefore, for the sake of assistance of the living beings the gathering of merit is to be made and for the sake of gathering knowledge (jniina) meditation on knowledge of the supreme unchanging is to be performed. Except for the sake of [helping] living beings, no gathering of merit occurs. Except for meditation on the knowledge of the supreme unchanging, [no] gathering of knowledge (jFiiina) [occurs]; such is the heart ofthe Tathiigata. Here, the importance of knowledge of the supreme unchanging for the gathering of know1edge is stressed. The knowledge (jniina) is not possible without combination with the supreme unchanging. Knowledge of the supreme unchanging precedes other knowledge. The supreme unchanging is consequently at the origin of knowledge, which is something that comes close to the concept of the unchanging A.dibuddha at the origin of everything. ato bhagavato vacaniid yoginii paramiiksaramahiimudriiyogena svacittasiidhanal[l kartavyal[l moksiirtham anyathii gurvajnayii mokso na bhavati / ,05 .

(VP p.91 :4; Bu p.185:4) Therefore, according to the Bhagaviin 's word, by the yogin, by the union with the mahiimudrii and the supreme unchanging, the stidhana of his own mind is to be performed for the sake of liberation; otherwise, by the authority (iijnii) of the guru, the liberation does not occur.

902 903 904 905

Vimalaprabhii V.3 in VP Vol.III. 1994:89, line 32; Bu-ston. 1965c:183, line 2. k,udra means very small, little. Consequently, K,udramantra means the small mantra. Vimalaprabhii V.3 in VP Vol.IlI. 1994:90, line 24; Bu-ston. 1965c:184, line 7. Vimalaprabhii V.3 in VP Vol.III. 1994:91, line 4; Bu.-ston. 1965c:185, line 4.

186

In order to reach the liberation (mok~a), it is necessary for the yogin to be in union with the female counterpart and "the supreme unchanging". This is a place where the concept of "the supreme unchanging" stands alone without the bliss or knowledge. This concept then must be another word for the totally transcended state reached in connection with the state of being in union with the Adibuddha. The following is a verse that is quoted from the malatantra: sivatatlVe kamatattve vi~atatlVe tridhii. bhavet I vedho gurviijiiayii pUl'{Isiil'{l paramiik~arasukhalT' na ca 11 906

(VP p.91 :29)As for the real nature (latlVa) of Siva, the real nature of desire (kama), the real nature of poison (vi~a), it [the tatlVa1may be threefold; yet, by the command of the guru, the supreme unchanging bliss for the human beings, is not [produced]. The supreme unchanging bliss cannot be reached by human beings on the guru's command. This state must be reached by the yogin himself. Also, a guru is normally not really qualified to lead the disciple to liberation. A real bodhisattva is needed. 907 The following text is placed just after the quotation from the mulatantra and is a sort of conclusion of the quotation. ato bhagavato vacaniit paramiik~arajiiiinamahiimudriibhiivanii kartavyii mok~iirthaneti I

908

(VP p.92:11; Bu p.188:1) Therefore, according to the words of the Bhagaviin, the meditation with the mahiimudrii for the sake of the knowledge of the supreme unchanging, is to be performed by the one who desires liberation. The mahiimadra could be a type of wisdomlknowledge. It is very important in order to reach the liberation to actually desire that liberation honestly. Here it should be noted that these meditations are to be practised for the sake of the knowledge of the supreme unchanging, without adding the bliss. In this verse paramiik~ara stands for itself, something that underlines that this is a concept of its own and not a qualification of other concepts. tad eva sal'{lSiiracakram tan na kasmiit bhagavata~ paramiik~ara­ vidyiidharatviit I iha hi bhagaviin vajrasattva~ paramiik~aramahii­ vidyiidhara~ sal!'siiraviisaniitikriinta~ tad vaidharmyelJa sal'{lSiirilJa~ k~aravidyiidharii~ sal'{lSiiraviisaniigrastii~ I tasmiitparamiik~ara mahiiriigo vidyii avidyii ihiiniidiriigavCisanii sattviiniim tayii riigapravrtti~ raga 'pi k~ara~ ~ariid viriiga~ I 909

(VP p.97:23; Bu p.202:5) Just that wheel of sal'{lSiira is not [the pratityaVimalaprabha V.3 in VP Vo1.III. 1994:91, line 29; Bu-ston.1965c:186. See this reasoning in Vimalaprabhii V.3 in VP Vol.IIL 1994:92 and in Hartzell. 1997:1358-1359. 908 Vimalaprabha V.3 in VP Vo1.III. 1994:92, line 11; Bu-ston. 1965c:188, line 1. 909 Vimalaprabha V.3 in VP Vo1.lII. 1994:97, line 23 -27; Bu-ston. 1965c:202, line 5. 906 907

187

samutpiida]; Why? Because the Bhagaviin holds the science ofthe supreme unchanging. Because the Bhagaviin, in this regard, [is] the Vajrasattva who is the great science-holder of the supreme unchanging, who has transcended the karmic imprints of sa1!1Siira. Because their dharma differs from him, the people living in sa1!1Siira are holders of the knowledge of destruction and are seized by the karmic imprints (viisanii) of sa1!1Siira. Therefore, the supreme unchanging, the great passion, is science, and there is non-science, in this sense, by the living beings with beginningless karmic imprints of passion, and from that [state] there is the source of passion, and from passion, destruction, and from destruction, aversion.

This part of the commentary on KCT V:127 treats the decisive battle engaged by the Kalkin, the king of Shambhala described in the KCT I: 150-170 and in KCT II:48-50. Verse KCT 1:48 is again quoted just before this quotation. 910 These texts were discussed at length in the chapter on Shambhala above (p.79-85). It is clear that Vajrasattva and the Bhagaviin (Siikyamuni Buddha?) know about the supreme unchanging and they are beyond the reach of karma and the wheel of life. Vajrasattva has a connection with the AdibuddhalKiilacakra as he has knowledge of the supreme unchanging. This is another indication of the transcendence of the concept of supreme unchanging. The karmic imprints (viisanii) are the impressions giving karma in former lives and affecting the present life. In several places in the KCT and the VP, this concept is mentioned. It is very important for being able to perform the liberating meditations and yogas in the Kiilacakra Tantra. It is also important that the concept of paramii!qara is treated as independent from bliss or knowledge. ato bhagavato vacaniit sa1!1Siiracakrarr< k~arariigo 'vidyeti I iha yadii tadii paramiik~aro bhavati I paramiik~aro mahiiriiga!; I mahariigiid viriigo Ila~!a!; I viriigo niima dve~a!; I dve~ak~asyiill mahiidve~o bhavati I 911 k~arariigo na~ras

(VP p.98:22; Bu p.205: 4) Therefore, according to the words of the Bhagaviin, the cycle of sa1!1Siira is the passion for the perishable, the non-science. In this sense, the passion for the perishable is destroyed, then the supreme unchanging comes to exist. The supreme unchanging is the great passion. From great passion aversion is destroyed. That which is called deprivation of passion is hatred. From the destruction of hatred, comes the great hatred (do~a). The hatred having been consumed, it becomes the great hatred.

This passage is quite enigmatic. The supreme unchanging seems to be a state when the passion has changed quality and reached the state of unchanging. Consequently, the supreme unchanging is the passion transcended. This idea has been expressed earlier in the text when, for example, the five skandhas could change their state of being in that way, being

910 911

See Hartzell. 1997:1374-1376; Vimalaprabhii V.3 in VP Vol.III. 1994:97. Yima1aprabhli Y.3 in VP VoI.IIl. 1994:98, line 22; Bu-ston. 1965c:205, line 4.

188

equalled to the unchanging when they are without defilements.912 Here also the concept of is treated as independent.

paramak~ara

e~am

uktanarrz kayavakcittavidyamaraIJarrz janakal:z k,aral:z k~anal:z kamadevo 'bhidhfyate I sa tathagatena vidhvastal:z paramak,arak~m:lena tasya bhango marabalabhango raIJa91J dve~amohakrodhanam avidyarilpaIJarrz k~ayal:z I iha k,aravasananirodhad ragadve~amohakrodhanirodhal:z e,arrz nirodhad avidyanirodhal:z I evarrz kramaso dvadasanganarrz nirodhal:z dvi'idaSiinganirodhad bhavacakrasya nirodhal:z bhavacakranirodhi'id buddhatvarrz niravaraIJarrz bhavatiti I e~u sravakaparamitamantranaye,u parama~arahrdayarrz vajradharabhagavato namasangftyarrz tathagatena deiitam I asyartham ajananto 'sadguravo na,ral:z paramak,arajfianabhra~ra anagate 'dhvani bhavi~yanti I tair vina~rail:z sattva vinasayitavyal:z I tena millatantre paficakarajfianastave paficaSiokaiJ:z paficakarabhavana bhagavatokta I tadyatha - silnye bhavasamilho 'yarrz kalpanarilpavarjital:z I drsyate pratiseneva kumarya darpaIJe yatha II iii lokottarasatye rilpaskandhi'idariajfianam sarvabhavasamo bhiltva eko bhavo 'k,aral:z sthital:z I ak~arajfianasarrzbhilto nocchedo na ca sasvatal:z II iti vedanaskandhal:z samatajfianam 914 (VP p.IOO:21; Bu p.210:1) The perishable moment that is the progenitor of these ones called the maras of the ignorance of body, speech and mind is described as Kamadeva. By the Tathagata, by a moment of the supreme unchanging, he was destroyed; his destruction was the destruction of the power of Mara, the destruction ofthe ignorance forms of passion, hatred, mental darlrness and anger. Here, through the cessation of the karmic inclination for the perishable, there is cessation of passion, hatred, mental darlrness and kroq.ha (anger); through the cessation of these, there is the cessation of ignorance. In this way, gradually, the twelve limbs are supressed and from the cessation of the twelve limbs the wheel of existence is suppressed and through the cessation of the wheel of existence Buddha-hood without obscurities comes into existence. Among these sravakas [Theravada], paramitas [Mahayana] and [followers of] the mantra-system [Vajrayana], the supreme unchanging heart of the Bhagavan Vajradhara was explained in the Namasangfti by the Tathagata. Due to no lrnowledge of the meaning of this and false gurus who are ruined, and have deviated from the lrnowledge of the supreme unchanging will occur in the future. The living beings are going to be destroyed by those destroyed [gurus]. Therefore, in this root-tantra, in the praise ofthe lrnowledge ofthe five forms and by the five slokas, the meditation on the five forms was described by the Bhagavan like this: Vimalaprabha V.3 in VP Vol.II!. 1994:60, line 25 - 61, line 3. Present text p.I78-79. Should be corrected to raga, according to the context in the following sentence. 914 Vimalaprabha V.3 in VP Val.lI!. 1994:100, line 21-101, line 6; Bu-ston. 1965c:21O, line I to p.211, line 2. 912 913

189

"In the void (Bu: which has gone beyond the indivisible particles), the entirety of existence has abandoned imagined form. This (Bu: emptiness image which has all the parts) can be seen (Bu: for example) like a prognostic image in the mirror by a young maiden. Thus in the truth beyond the material world (the lokottara truth), there is the mirror-knowledge of the form aggregate (skandha). The entire existence having become the same, the single existence is established as (Bu: supreme) unchanging. The knowledge and the unchanging being united, there is no cutting off (Bu: following the existence of the void), nor is it [the existence] eternal (Bu: gone beyond the indivisible particles). Thus, the skandha of sensation, the equality knowledge (jfiiina).,,915 (VP pJOl:6; Bu p.211:2). Here a moment of the supreme unchanging is mentioned, which consequently, is just unchangeable and contains an eternal moment. It is also written that the supreme unchanging heart of Vajradhara was explained in the Mafijusrf-niima-sangfti CMNS). This could mean that the indestructible drop in the heart of Vajradhara is explained. Mara and Kamadeva are destroyed by using the moment of the supreme unchanging and all the constituents of the world are suppressed. Ignorance is also suppressed and likewise, the chain of the twelve limbs is suppressed. If the yogin abandons the knowledge of the supreme unchanging, he is going to deteriorate.

tathii niimasangilyiirrz va]radharabhagavataF! paramiik$arajfiiinarrz buddhabodhisattviiniirrz hrdayabhutarrz tathiigatena prakiisitarrz dvii~a~fYadhikasataiF! slokaiF! siidhye~atJaiF! /916 (VP p.l02:1; Bu p.212:4) Accordingly, in the Niimasangiti the supreme unchanging knowledge of the Bhagaviin Vajradhara that is the heart of the Buddhas and Bodhisattvas, was perfectly taught by the Tathiigata with the 162 slokas together with the solicitations for instruction (Bu: on the position of the six cakras which are provided with the six root-families).

It is stated here that the supreme unchanging knowledge is at the heart of Vajradhara and the Buddhas and the bodhisattvas. It is similar to the indestructible bindu in the heart. The text MNS consists of 162 slokas. In the following page, there are many verses where information about different deities is to be found. At the end of this passage is the following: ebhir dvii~a~fYadhikasata§/okaiF! sarvayiine~uddhrtya sangrhitarrz vajradharabhagavato hrdayarrz samantabhadrarrz paramiik~ara­ mahiisukham iikiisadhiituparyantarrz samantiid avabhiisamiinarrz visuddhajfiiinasambhiirasambhutat!! 917 samatajiiana is one of the ftvejifanas. Vimalaprabha V.3 in VP VoI.Il!. 1994:102, line 1-2; Bu-ston. 1965c:212, line 4. 916 Vimalaprabh1i V.3 in VP VoLIIl. 1994:102, line 16-18; Bu-ston. 1965c:214, line 4. 915

916

190

(VP p.l02:16; Bu p.214:4) Having been drawn out from all the yiinas by these 162 verses and gathered together, the Bhagaviin Vajradhara's heart [is described as], being extef\ded in all directions in the space realm, completely good (samantabhadra), [as] the great bliss of the supreme unchanging (paramiik~aramahiisukha), [and as] provided with materials for the completely pure knowledge (visuddhajiiiina) and shining forth in every direction.

In this passage there is a continued worship of the formerly mentioned text, Niimasahgfti. The supreme unchanging is there, but it can also, as in another place in the MNS text, mean the supreme syllable. Here the heart of Vajradhara is considered to be the supreme unchanging great bliss and has also other qualifications. etad eva tribhuvanamahanfyal!' yogijiiiinal!' svasal!'vedyal!' na tyaktavyam iti tathiigataniyamal:< I asya bhiivanii mulatantrariije jiiiinapatale tathii tathiigatenoktii I tadyathii dhumiidfn bhiivayitvii tu cittal!' krtvii tu niscalam I madhyamiiyiil!' sodhayitvii bhiivayet paramiik~aram II padme vajral!' prati~thiipya priil}al!' bindau nivesayet I bindl1~ cakre~u binduniil!' spandal!' vajre nirodhayet II stabdhalingal:< sadii YOgll1rdhvaretiil:< sadii bhavet I mahiimudriiprasangena vajriivesair adhi~thital:< II eka vi~atsahasrais ca ~atsatail:< paramiik~arail:< I k~al}ail:< purl}air mahiiriija vajrasattval:< svayal!' bhavet II 918 paramiik~arasukhal!' yoginii

(VP p.102:23; Bu p.215:2) This itself is receiving offerings in the three worlds, the self-knowable perception of yoga, the supreme unchanging bliss, not to be abandoned by the yogin, [Thus it is] established by the Tathiigata. The meditation on this, in thejiiiina (knowledge)-chapter of the mula-tantra-riija (root-tantra), has been described like this by the Tathiigata: "- After having meditated on smoke, etc., (Bu: by Pratyiihara, "individual convergence" 919 [the 1,( limbD, - and having made the mind (citta) immovable (Bu: by dhyiina, "individual stability" [the 2nd limb of ~a4angayogaD, - After having purified [the citta] in the middle [channel] (by the priil}iiyama, "life-effort" (the 3rd limb) and the vajra-recitation)920, one should cause the supreme unchanging to be made into existence. And having placed the vajra (Bu: wind-mind;) in the lotus (Bu: ofthe six root-cakras), one should make the priilJa (Iife-) (Bu: -wind), enter into the bindu (drop) (Bu: abiding in the forehead [that was the 4th limb, dhiirmJii, Vimalaprabhii V.3 in VP VoI.III. 1994:102, line 23-33; Bu-ston. 1965c:215, line 2-6. The 1st limb of the ~a¢aftga-yoga; the six- limbed yoga of the completion stage ofthe Kalacakra Tantra. 920 "Vajra-recitation" is meditation of the completion stage with the goal of drawing the 10 energies into the central channel (avadhiiti) , and then into the indestructible drop (the nada in the hindu) at the heart. (Dhargyey. 1985:137). 918

919

191

"retention"]). - (Bu: By the uttering ofHA and by the gtum-mo (inner heat)"l in the anusmrti, "recollection" [the 5th limb J), and [make1the bindus [enter into1the cakras; the motion of the bindus (drops) in the vajra, in the cakras of the bindus (Bu: of the root of the six cakras) should be halted. - (p.2IS:S) (Bu: Through the samiidhi, "concentration",[the 6th limb of the ~a sattva,!, padmarrz prajfia evarrz vajrasattva/:l / uktarrz bhagavata tantraraje jfianapata1e - prajfiopayamhujarrz 921 This is the Hinner heat", skt. caMalr, which has been made known as one of the six yogas of Niiropa (Evans-Wentz. 1968:155-250). 922 See this work, p.118-19. 023 Compare with Dhargyey. 1985:91. I have treated this text earlier in this work (p.173).

192

vajrarp. slidhlirlidheyam ucyate I tayor dvandva". samlipattir vajrayogo 'dvayo 'k~ara/.lli. caturdhli vajrayoga", ta", kiilacakra", namlimy aham I kallipe nirgato rlijli paUl:u!arjko 'bjadhrk svayam 1/127 11 924 (VP p.103:14; Bu p.216:4; to the end of this subchapter) Wisdom [is] the living being [and] the lotus, thus [is] Vajrasattva. This was stated by the Bhagavlin in the Tantrarlija, in the chapter of knowledge (jiilinapata1a): "The water-born (lotus) (Bu: is the void which has all parts, and is a being) of wisdom (prajiili) and method possessing the vajra is called the support and the supported [that which has gone beyond the support and has not come]. Those two (Bu: upliya-prajiili and supportsupported) is the meeting (samlipattl), (Bu: into the same taste), the vajrayoga, the non-dual [and] the unchanging. I pay respect to that fourfold vajrayoga, the Klilacakra. In Kallipa the king PUIJtf.arfka has emerged, possessing the water-born (lotus) himself." (vp p.103:18; Bu p.216:6)

This last passage of the third subchapter mahoddesa of the fIfth chapter (jiiana-patala) of the commentary to the K€T, Vimalaprabha, contains a short resume of the essence of the chapter in stressing the non-dual and the unchanging character of the Kalacakra and the vajrayoga which seems to be a term resuming all the tendencies of unity of opposites which occur in this tantra. The unchanging is the non-dual and that which has come together. Consequently, when the upaya and prqjfiii have merged, the unchanging emerges. There is in these texts a movement in two directions. Both a principal of origin when the world emerges from the unrnanifested "Adibuddha", and the other way around in the mind of the yogin when he reaches a merging with the unmanifested principle seen as an "Adibuddha" .

6.1.2. Commentary. What is the concept of the paramiikfiara, the supreme unchanging?

An analysis will now be made of the concept of paramii/qara, the supreme unchanging, on the basis of the texts translated here and other material. The concept of alqara is also important in Indian philosophy in general. P.M. Modi has written on this concept in the Bhagavadgitii and other Hindu texts and he gives a number of possible translations of the word, especially "the imperishable", "the immutable", "brahmall", the supreme iitman" and "tlie liberated soul".925 The main concept in verse KCT V: 127 seems to be the concept of bindu; (tib. thig-le; drop, small point, "essence"). Bindu has in other tantras basically the meaning of the point at the centre of the malJeJala where all thought-creation (bhiivanii) is absorbed. Hence, it 924

925

Vimalaprabhii V.3 in VP VoI.III. 1994:103, line 14-18; Bu-ston. 1965c:216, line 4-6. Modi. 1932:2-3.

193

represents the void (§unyata) or the moon, which is the bodhicitta in its absolute aspect. It can also mean bodhicitta in its relative aspect as white bindu (the semen) and red bindu (the woman's menstrual blood).926 It is not evident that this description is valid for the' Kalacakra Tantra because its content has been quite unknown among western scholars until recently. Bindu is introduced in this part of the tantra inverse KCT V:126 and there it is said that the fourfold citta is placed in the middle of bindu of all the sentient beings. The bindu is then said to be liberated and gone to the superior bliss (paramasukha) in the blja (seed, semen) produced by the yogin. Then the bindu is thrown out in all directions. The concept of bindu is explained in different places in the Kalacakra. In the Vimalaprabha, bindu is explained in connection with the letters. Bindu is the small point above the halfmoon in for example the seed syllable HOM when written in Tibetan. 927 Above it is the nada which is formed like flame (or crest).928 These concepts are used in the ~a4aizgayoga of the completion stage (utpannakrama). To end a meditation, the half-moon of visarga merges in the bindu, then the bindu merges into nada, and subsequently, this dissolves into the Void.929 Bindu also indicates bodhicitta. In the present, verse KCT V:127, this concept of bindu is said to have its origin in the unchanging (skt. ak~ara, tib. 'gyur-med). Bindu has also gone to the end of change, something that expresses the same idea as the foregoing. Bindu is the master of all the jinas which is a quite strange expression. Normally in this text the master of jinas is the "A.dibuddha"-type of deities like Kalacakra, Vajrasattva, Vajradhara. Bindu has taken a very wide meaning here. It can be considered equal to the Kalacakra. To conclude, it is implied in the text that bindu is behind the illusion of this material world, which can mean that the material world has its origin in bindu. Perhaps it could be that bindu in the heart cakra produces the illusion in the microcosmos perspective. But bindu is not the "absolute", because, as is explained in the great commentary (VP) in another place in this text: "Therefore, Sahajakaya has originated from the unchanging.',93O This leads to the conclusion that bindu and sahajakaya can be put on equal basis. One can see from comparing with parts of the subchapter on the four bodies that sahajakaya also has its origin from something else that is called "A.dibuddha"931 In order to understand this, it is necessary to compare with the description in the completion stage of the six -limbs-yoga where it is told that consciousness comes into existence from the indestructible drop.932 This concerns the human body and it can be noticed that there is a "forever indestructible drop" which refers to the "extremely subtle consciousness and energy (or wind)" inside "the drop" (bindu) which is indestructible for the duration of life and is located in the Snellgrove. 1959: Part I, p.135. Vimalaprabhii 1.2 in VP Vo1.I. 1986:58, line 18; Newman. 1987a:440. The annotations by Bu-ston are translated by Newman. 1987a:441-442, Bu-ston. 1965.:435, line 2-6. 928 Vim.laprabhill.2 in VP Vol.I. 1986:56, line 4-5; Newman. 1987a:429. 929 Dhargyey. 1985:94-95. 930 Vimalaprabha V.3 in VP VoI.III. 1994:60, line II; Bu-ston. 1965c:IOI, line 5. 931 Vimalaprabhii V.3 in VP VoLIII. 1994:45, line 14; Bu-stan. 1965c:80, line I. See above, p.159-60. 932 Dhargyey. 1985:91. 926 927

194

heart-cakra. This bindu is actually totally indestructible throughout all the existences (life, death and intennediate stage).933 This might give a key to the statement in the VP of the KCT V:89 that the Sahaja was caused in a fonner life in the navel, so now it has ripened in the dharmacakra of the heart as the Dharmakaya. As the indestructible drop is situated in the heart, it manifests as the active principle of Dharmakaya in the heart. 934 This kind of philosophical basis is perhaps difficult to accept from a Madhyamika point of view of there 'being nothing pennanent and indestructible. Here perhaps this tantra introduces something new in Buddhist doctrine. In analogy with the macrocosmosmicrocosmos perspective of the whole tantra, this is also valid for the outer world. Perhaps here can be seen the idea of something which is beyond everything, indestructible and eternal and sometimes called Adibuddha, although these texts mostly treat the first manifestation level of the world expressed in this tantra as Sahajakaya/Suddhakaya, Kalacakra/Vifvamata, prajfia/upaya and the supreme unchanging bliss of wisdom Ufiana) which results from contact with this indestructible that exists eternally. Perhaps a reason that this concept of something indestructible is not discussed very much in this tantra, is that it is beyond description. It could also be suspected that it was not emphasized because it is not really an orthodox doctrine of the dominating buddhist philosophical school of Madhyamika thought. Here the origin of the Jo-nang-pa school of Buddhism being what has been called substantialistic might be found. The Void is free from an absolute substance and this teaching is called the "gzhan-stong" -doctrine. It could be that it was Dolpo-pa (14th century) and his predecessor Yu-mo (beginning of 13th century) who understood the true essence of Kalacakra. It seems from the basic texts that there is something "absolute" in this philosophy. Probably, though, the concept of Adibuddha is many times purely temporal and stands for the one who obtained buddhahood first. The crucial point is that there is something before and behind the sahajakaya. Returning to the VP of the KCT V:127, there is the concept of non-transmigration or pennanence (skt. acyuta, tib. mi- 'pho-ba) which is mentioned above'35 and there is a possibility of interpretating this word as describing a continued existence over life, intennediate stage and death. There exists also the possibility that the idea of transmigration is produced in the Tibetan translation, that there is a difference of interpretation. In the Kalacakra texts there can be found indications that there really exists something, a continuum of the extremely subtle consciousness and energy that exists asthe basis of an indestructible drop (bindu-nada), which continues to exist from life to life. Considering the existence of such a phenomena, it is possible to affinn that there is not really transmigration in the Kalacakra, because something always continues to exist. So, it does not mean that there is not reincarnation, but that there is an infinitely small bindu which continue from one life to another. Earlier in the text 936 it is said that the knowledge Ufiana) of the supreme unchanging bliss is not transmigrated. What is meant by that? If this wisdom is not transmigrated it must be continued, eternal? Later in the text it is said that bindu (drop), when it is in the Dhargyey. 1985:91. Vimalaprabhii V.3 in VP Vol.IIl. 1994:46, line 5; Bu-ston. 1965c:81, line 3. See above, p.163-64. 93' It is mentioned in the beginning of the present chapter (p. I 76-77). Vimalaprabha V.3 in VP Vol.lII. 1994:60, line 16; Bu-ston. 1965c:102, line 4. Das. 1976(1903):849. 936 Vimalaprabhii V.3 in VP Vol.IIl. 1994:60, line 16; Bu-ston. 1965c:l02, line 4. See above, p.176. 93J

934

195

supreme unchanging, does not become transmigrated. 937 Here hindu in this meaning is also having a continued existence. It is a special kind of bindu which also is said to have become the Void. If this is correct, then the Void (sunya) is the supreme unchanging. Later on in the text it is stated that the supreme unchanging is the moment of not being transmigrated. The momentaneous supreme unchanging is consequently outside of the wheel of existence. 938 Still further on, it is again stated that if a yogin is skilled in the supreme unchanging bliss, he has abandoned the bliss of transmigration. 939 In consequence, it is plausible to say that it is possible to abandon transmigration with a technique using the hindu of the unchanging bliss. There exists 3,600 drops (hindu) of white bodhicitta in each of the six cakras. These drops are drawn up through the subtle body and in the end are drawn into the crown cakra where the special Kalacakra eleventh and twelfth Bodhisattva grounds are attained. In all, there are 21,600 drops of the white bodhicitta and consequently also 21,600 unchanging blisses which act as antidotes for the material components in the body.940 All these components and active energies have to be exhausted. For that purpose, one experiences a supreme unchanging bliss which exhausts all the material components and also the red and white bodhicitta. 941 Here, there is a mixture of the hindu (drop), the ak~ara-sukha (the unchanging bliss) and the paramak~ara-sukha (the supreme unchanging bliss). The conclusion that can be drawn from this, is that there is a difference between "unchanging bliss" and "supreme unchanging bliss", the former being manifold and related to the charmels and drops in the so called "subtle body". The second concept is only one, there is really only one supreme unchanging bliss. Returning to the VP on KCT V: 127, it is mentioned that through the sound of the unchanging (or: the syllable), the knowledge (jFzana) of the supreme unchanging bliss is Vajrasattva. 942 This can be systhematised as follows: parama~ara

- the supreme unchanging + the sound of the unchanging Vajrasattva

There are also several unchangings, two groups of five and six corresponding to the elements and senses deprived of obscurities (tib. sgrih-pa). Consequently, the unchanging is the purified elements, etc. The elements in themselves are beyond change. Later in the text Vimalaprabha V.3 in VP VoI.IlI. 1994:61, line 4; Bu-ston. 1965c: 104, line I. VimalaprabM V.3 in VP VoLIlI. 1994:61, line 19; Bu-ston. 1965c:105, line 2. 9" VimalaprabM V.3 in VP VoLII!. 1994:88, line 27; Bu-ston. 1965c:180, line 2. 940 Compare with the earlier treated (p.132) discussion on the 21 ,600 paramak~aras. See Vimalaprabha 1.5 in VP Vol.I. 1986:44, line 23-25; translated in Newman. 1987a:375 and VP VoLl. 1986:44, line 12-15; translated in Newman. 1987a:374. 9" Dhargyey. 1985:144-145. For this discussion see also Geshe Lhundrup Sopa. 1985: 148-150. Also published as "An Excursus on the Subtle Body in Tantric Buddhism.", Sopa. 1982: 942 Vimalaprabha V.3 in VP VoLIII. 1994:60, line 22 and Bu-ston. 1965c:103, line 2. 937

938

196

it is stated that the skandhas, dhiitus and iiyatanas become one in the bindu in the body (see above, p.l61). This bindu becomes the void (sanya). This hindu, as it is not transmigrated, is revealed in the supreme unchanging. Sahajaktiya is described as without sexual distinction and on that level Vajrasattva is also to be found. Kiilacakra is on the level of supreme unchanging bliss. 943 As this is the level of bliss, it is already not the supreme unchanging, but the level where sexual distinction occurs (Kiilacakra/Vi.fvamiita). In another way it can also be said that the knowledge (jFiiina) of the supreme unchanging bliss is that which is achieved by purifying the drop (bindu) situated in the navel cakra, which is related to the bliss resulting from sexual union. When this has been purified one achieves the vajra knowledge (jFiiina). A good overview of the problem if there exists an immobile, permanent self or not in the Indian religions has recently been published by Johannes Bronkhorst where he states that permanence has been a theme in Indian religions since ancient times. There is a strong tradition of the immobile self (iitman) and the immobile absolute principle (brahman) in different traditions of Hinduism but in Buddhism, the different theories of the small dharma entities are dominant. 944 This normally leaves no place for any absolute self or absolute eternal principle, but in the Kiilacakra Tantra there seems to be some sort of idea of an absolute self and an absolute principle like the Adibuddha

6.2. CONCLUSIONS - THE RELATION OF PARAMAKI;;ARA (THE SUPREME UNCHANGING) TO SHAJAKAYA AND THE ADIBUDDHA.

The above 2uoted material can be summarised as follows from the Vimalaprabhii p.60 up to p.80:28 9 5: Transcendent level: The Supreme unchanging - Paramiilqara (contains the bindu transmigrated)/ A /The moment of no transmigration. - It has passed beyond the dharma's of indivisible particles. -It is the cause which has consumed all the obscurities. The first manifestation level: Sahajakaya - Vajrasattva (= the essence ofprajFiti and upiiya) -The most perfect Buddha -The bindu of all beings - Jinapati (= master of Jinas) ." Vimalaprabhii V.3 in VP Vo1.III. 1994:61, line 4 and Bu-ston. 1965c:104, line I. .... Bronkhorst. 2003:81-105 . • 45 See Vimalaprabhii V.3 in VP Vol.III. 1994:80; line 28 and Bu-ston. 1965c:159, line 5. See above, p.17484.

197

- Samantabhadra - has the supreme unchanging bliss which is the wisdom ofthe mahiimudrii and the essence of the fourth bliss. - The Buddha-essence is non-existence and attached to the knowledge of the completely pure supreme unchanging bliss. The next level of manifestation: Kiilacakra / [Visvamiita] - The supreme unchanging bliss [BU-stOll:] The knowledge ofthe supreme unchanging bliss (= the own nature of knowledge characterised by Time)946

E jiiiina

VAM jiieya

Vajrasattva is the union of E and VAM and also ofjiiiina andjiieya. From a later passage there follows some quotations that treat how a yogin can practice in order to achieve the supreme unchanging bliss. For the sake of liberation, a yogin should meditate mi the supreme unchanging wisdom and the mahiimudrii. The supreme unchanging knowledge (jiiiina) is something that can be achieved by ayogin. 947

6.2.1. Some remarks on the last part ofthe commentary on KeT V:127. 948

In the last two quotations, the three causes for the world of cyclic existence to go around, i.e. riiga (desire-attachment), dve~a (anger-hatred) and moha (mental darkness) are treated. It is considered that there exists one great riiga, dve~a and moha. A very remarkable thing is that the concept of the supreme unchanging is equated to the concept of Great Desireattachment. Something similar can be considered here, as in fonner passages where the unchanging is compared to elements, etc., without obscurities. When the desire-attachment is destroyed, it becomes the supreme unchanging. Then it is the Great desire-attachment. This is perhaps just a way of saying that when the desire-attachment, etc., are without obscurities, they are like the supreme unchanging. Later on, there is an interesting passage where it is said that the desire (tib. 'dod-pa) is subdued by the moment (tib. skad-cig; skt. k~G/Ja) of the supreme unchanging. This means that the karmic imprints (tib. bag-chags; skt. viisanii) of change have been stopped. Time as the moment here plays a crucial role in the meaning that the stopping of Time , leads to the supreme unchanging. 949

Vimalaprabha V.3 in VP Vol.III. 1994:62, line 16; Bu-ston. 1965c:107, line 1-3. Vimalaprabha V.3 in Vol.III. 1994:88, line 27; Tib. Bu-ston. 1965c:180, line 2. 948 Vimalaprabha V.3 in VP Vol.III. 1994:97, line 23-27; Tib. Bu-ston. I 965c:202, line 5; and p.98, line 22; Tib. Bu-ston. 1965c:205, line 4. 949 Vimalaprabha V.3 in VP Vol.III. 1994:100, line 2; Bu-ston. 1965c:210, line 1. 946 947

198

In this context, is also mentioned that it is the Bhagaviin Vajradhara (tib. rDo-rje 'dzin-pa) in whose mind these methods have been conceived. Vajradhara in his tum taught it to the Tathiigatas (the five jinas). Who is then Vajradhara in this context? It could be another name for the "Adibuddha"-concept, although Vajradhara is a seldom used word in the Kiilacakra texts. Later, especially in the Tibetan Buddhist school of bKa '-brgyud-pa, Vajradhara takes on the role of "Adibuddha", but in these texts the concept is not so clear. Below is also mentioned that "the supreme unchanging knowledge of the Bhagaviin Mahiivajradhara is transformed into the mind of the Buddhas and Bodhisattvas".95o This could mean that Vajradhara (or Mahiivajradhara) is identified with the supreme unchanging and could be seen as a personified Adibuddha. There are problems with this identification because the Tibetan word rDo-rje 'dzin-pa in the text can be used for Vajradhara, but can also mean "the one who grasps the vajra". The later conventional translation of Vajradhara to Tibetan is rDo-rje 'chang, and this translation is not used in these texts. This is all the more striking as in the Mafijusrf-niima-sangiti (MNS), which is basic for the Kiilacakra Tantra, VajradharaIrDo-rje- 'chang is mentioned in several places. In the MNS, Vajradhara is equalled to VajrapiiIJi and it was only later that the two divinities became separated and Vajradhara became the "Adibuddha" of the Guhyasamiija Tantra and other tantras. Later it is mentioned that the mind of Vajradhara is the great bliss of Samantabhadra paramiilqara (the supreme unchanging).951 Here perhaps an identification of the supreme unchanging is made with Samantabhadra who later was identified with the"Adibuddha"concept in the rNying-ma-pa school of Tibetan Buddhism, but in other parts of the KCT and the VP I have not found this name. Samantabhadra can also mean "the completely good". I have written more on the relationship between the Kiilacakra texts and the MNS above in the third chapter above. Here can only be mentioned that in MNS verse 111, "visuddhaJ:! paramiik~ara" is translated as "he is pure with the supreme syllable".952 The Tibetan "yi ge mchog ste mam par dag" is different from the translation as "the supreme unchanging." But it is interesting that the same Sanskrit expression is used. Finally, a comment deserves to be made on another earlier translated text. 953 There seems to exist a way of saying that the supreme unchanging is beyond everything, even the eternal does not exist. There is no descendence from the Void. But there exists something beyond the indivisible particles (tib. rdul-phra; skt. paramiilJu). The relationship of the supreme unchanging to the Void is not clear in this context. There is a contradictory statement here that even the eternal (tib. tag-pa) does not exist. A solution to this could be that this is another way of saying that it is really impossible to say anything positive about "the absolute". The last part of the VP commentary on KCT V:127 tells about the relationship between the six-limbed yoga (~aljanga-yoga), which is the essence of the practice of Kiilacakra, and the concept of the supreme unchanging. The experience of the supreme Vimalaprabhii V.3 in VP Vol.lI!. 1994:102:1-2; Tib. Bu-ston. 1965c:212, line 4. Vimalaprabhli V.3 in VP Vol.III. 1994:102:16-18; Tib. Bu-ston. 1965c:214, line 4. 952 Davidson 1981:18. 953 Vimalaprabhli V.3 in VP Val.lI!. 1994:101, line 4-5 and Bu-ston. 1965c:211, line I. See above, p.190. 950

951

199

unchanging bliss in the sixth limb of that yoga has a relationship with the retention of the semen. 954 This has to do with the ultimate goal of this yoga which is to stop every motion and to stop time (kala). When one has reached that goal, one will experience the great bliss, which in this context is the same as the supreme unchanging bliss.

7. FINAL CONCLUSIONS.

I have made conclusions after each chapter and I will not repeat everything here. The historical part of this work establishes the dates of the introduction af Kiilacakra to Tibet as some time between 1030 and 1040 by the Indian Bhadrabodhi and his Tibetan translator Gyi-jo Zla-ba 'od-zer. Then the two schools of Kiilacakra, the 'Bro and Rva took shape. During the first three centuries of the existence of this teaching in Tibet it was partly dominated by members of the Jo-nang-pa school of Buddhism. This means that the Kiilacakra Tantra played a crucial role in the formation of the gZhan-stong theory of emptiness from something. Bu-ston himself sems ta have disregarded this influence as he was an adherent of the rang-stong theory emptiness from itself. The dGelug-pa school, and today, the present Dalai Lama has their tradition from Bu-ston, not the Jo-nang-pa. It is not an easy task to fmd a solution of how to define the doctrine of Adibuddha in the Kiilacakra texts. A comparatively simple solution is to hold that Adibuddha is just another way of describing the tathiigatagarbha concept, which means that there is a Buddhaseed in human beings which is always there. In that case, it is a way of saying that one must strive to obtain the state of Buddha-hood. It can also be a way of describing the Void (sunyatii) which is also present everywhere. Despite the above mentioned arguments, it is still possible to state that there is a concept of an original idea of a "Buddha" out of which everything originated. In that way the connection with the concept of the fourth body which is drawn out from the Adibuddha is evident. The fourth body, Sahajakaya or Suddhakaya, is a sort of primordial manifestation in the world. Of course, then the fourth body has many other connotations more on the personal level, but the cosmological level is also there, connected with the origin of the five jinas.

The concept of the supreme unchanging bliss, paramiilqara-sukha, can possibly be regarded as a qualification of the Fourth body. The supreme unchanging then should still be on the level of the teachings of non-transmigration and represent the bindu that is eternal from life to life in a human being. The Adibuddha concept is qualified with various epithets as shown above. The most important being: omniscient, without qualities, master ofjinas, without mental constructions, unchanging, or indestructible, bliss (alqarasukha), non-dual, progenitor of the Buddhas, simultaneouslyarisen master ofjinas, beyond origination and dissolution, non-dual wisdom and method, pure yoga (suddhayoga), without causal connection (niranvaya), supreme (parama), the 95. Yim.1.prabhii Y.3 in VP Yol.III. 1994:102:23-33; Tib. Bu-ston. 1965c:215.·

200

one who fIrst (adi) obtained Buddha-hood, without beginning in time, without termination, indivisible vajrayoga, endless Buddha, the supreme unchanging (paramakeara) (see above, p.l39-140). All these qualifIcations are strong evidence of there existing a concept of something transcendent beyond the existing world and this transcendent concept could be called the "Adibuddha". Actually, these qualifications can also be applied to other deities or principles, though the importance is that there exists such a concept. As found in KCT V: 127, there also exists a concept of bindu which can be compared to the Adibuddha concept on the individual level of the human body. The bindu stands for the indestructible or unchangeable in the heart cakra ofthe human body. This indestructible drop is described in a similar way as the Adibuddha. Consequently, it is shown how the concept of Adibuddha has a macrosmic and microcosmic interpretation. The fourth body of the Buddha, the sahajakaya, suddhakaya and svabhavikakaya can also be associated with pure, unchanging mind which is beyond everything. Sahajakaya being beyond prajfia and upaya, wisdom and method. Finally, the concept of the knowledge (jflana) of the supreme unchanging (bliss), paramiikearasukha jfiana, can be compared to the transcendent concept of something unchanging or indestructible. This last concept is more of a personal concept describing the final state of bliss which can be reached.

201

APPENDIX 1. The Tibetan text of Zhang zhung chos dbang grags pa's commentary on KCT V:89 on the four bodies.

I will here quote the Tibetan text of Zhang zhung chos dbang grags pa 1983, p.291:4 297:2. (p.291 :4) gnyis pa mdor bsdlls kyi gZhllllg bshad pa la gSlim I 'bras bu 'i sku dang gnas dang 'phrin las bshad pa I rgya dbang dang lam gyi rnam gzhag bshad pa I sku beu drug gi rab dbye bshad pa '0 I I dang po la gsum Ilhan eig skyes pa 'i sku'i mtshan nyid rgyas par bstan pa I sku de dag gang du bzhugs pa 'i gnas bstan pa I (p.291 :5) 'phrin las kyi de nyid rgyas par bshad pa '0 I I dang po la gnyis I sku bzhi'i mtshan nyid bshad pa dngos I sku geig las sku du ma spro ba'i tshullo I I (p.291:6) dang po la gsum Ilhan cig skyes pa'i sku 'i mtshan nyid bshad pa I sku lhag ma gsum gyi mtshan nyid bshad pa I rigs drug dag pa dang sbyar te bshad pa '0 I I dang po ni tshigs su bead pa gya dgu pa nas brgya beu geig pa 'i rkang pa gsum pa yan ehad ni ye shes kyi dkyil 'khor spro ba'i ngo bo nyid kyis gnas pa bdun pa yin la I (p.291 :7) kha eig (dol phyogs955 shes pa dang shes bya mam pa kun gyi bdag nyid kyi gnas pa dgu pa la 'chad (p.292: 1) de dgag pa sogs ni Ie 'u 'grel bshad du gsungs zin to I I shes rab ma yin zhes pa la sogs pa ste 'djr phyi nang gzhan gsum la thabs shes zung re bzhag sle I de yang nang bskyed rim dang rdzogs rim gyi skabs 'gar 'dzag pa 'am g.yo ba 'i dga' ba bzhi la beu drug tu phye ba'i tshe I (p.292:2) shes rab ni eha dang po beo Inga'i bdag nyid de dkar po 'i phyogs so I I thabs ni nag po 'j phyogs te zla ba khu ba 'i eha beu drug nyams pa 'i phyir ro I I de la dkar phyogs shes rab dang nag phyogs thabs su byas pa ni bsam pa'i sgo nas bzhag pa sle I (p.292:3) de 'i rgyu mtshan yang khu ba'i eha nyams ma nyams kyi dbang gis yin par 'grel pa las gsungs pa 'di nyid do I I nang dang gzhan gnyis ka la yang dgos pa'i dbang gis eha beu drug pa 'i tha snad yod la I gzhi dus kyi eha beu drug pa (p.292:4) nyams pa ni gsang chen gyi phyi rol tu khu rdul 'dzag pas nyams pa yin kyang lam gyi 'dzag bde 'i eha beu drug pa ni thig Ie gsang gnas kyi phyi rol tu 'dzags pas nyams pa min gyi thig Ie gnas gzhan du g.yo ba'i phyir mi 'gyur ba'i bde chen la bltos te (p.292:5) nyams par bzhag pa tsam mo I I de bzhin du dkar po 'j phyogs ni mtshan mo ste zla ba 'j cha bco Inga yod pa '0 I I nag po 'i phyogs ni nyin mo ste nyi mas zla ba 'j 'od zer zil gyis mnan pas zla ba 'j 'od zer med pa '0 I I de 'j phyir lhan eig skyes pa 'i sku ni shes rab eha beo (p.292:6) fnga'i rang bzhin ma yin fa I thabs eha beu drug nyams pa nyid kyang ma yin pa 'di ni sangs rgyas mams kyi fhan cig skyes pa 'i sku ste de Itar 'bras dus kyi mi 'gyur ba'i bde chen ni yod pa dkar po 'i phyogs eha beo lnga'i 'dzag bde'i mthar ltung ba minnol I med pa ste eha (p.292:7) beu drug pa 'i dngos po med pa nag po 'i phyogs kyi mthar ttung ba man no I I dkar phyogs nag phyogs yod med de gnyjs ka yin pa 'i mthar Itung ba min te I dkar phyogs nag phyogs 'di dag phan tshun 'gal ba 'i phyir I de gnyis gzhi mthun du

95' Dol phyogs is short for Dol-po-pa and lo-nang Phyogs-las mam-rgyal. It is not Bo-dong Phyogs las mam rgyal. See Stearns. 1999:192, note 193.

202

tshogs pa med do II (p.293:1) yod med gnyis ka'i bdag nyid min pa 'ang min zhes pa ni I dkar po dang nag po 'i phyogs 'di dag ma gtogs pa cha hcu drug pa 'i 'dzag bde yang Ihan cig skyes pa 'i mi 'gyur ba'i bde ba de min no II de ltar mtha' bzhi yongs su (p.293:2) dag pas eha beu drug pa ste I de 'i eha beu drug ji Itar byed pa ni tshigs su bead pa don drug pa'i skabs su bshad zin la I stong pa nyid kyi bzugs kyi ehos can gyi sku dang ni thugs lhan eig skyes pa mi 'gyur ba'i bde chen ehu dang gsher ba bzhin du grub bde dbyer (p.293:3) med 'brei mi rung du tshogs pa 'i sku na Ihan eig skyes pa 'i sku ru gsungs te I de yang sku 'i eha nas stong gzugs kyi sku zhes brjod la I thugs kyi ngos nas bde pa chen po 'i sku dang Ihan eig skyes pa'i sku zhes brjod cing I thugs de'i yul dag pa gnyis (p.293:4) Idan gyi eha nus ngo bo nyid kyi sku zhes bya ste I de la ska ma gnyis kyis khyab par bzhag tu mi rung ba ni dag pa gnyis Idan du der 'jog pa'i dbang gis so I I de 'i phyir ngo bo nyid skur gyur pa'i 'dus byas dang I de'i rigs 'dra bzhipa'i (p.293:5) thig Ie 'i stengna rdul du ma grub pa 'i eha geig dang I bde chen sgyur rung gi nus pa'i eha 'dus byas gcig 'jog dgos te rje btsun bla mas rdzogs rim mal 'byor chen po 'i bshad par gsungs shing I 'di nyid kyi gong 'ogmams suyang bshad (p.293:6) dol I snga ma dag gis sku 'di'i mam gzhag cham yang dpyis phyin par ma bshad do I I mal 'byor pa ting nge 'dzin gyi yan lag thob pa yanchad mams kyi rten thig Ie 'i brtsegs pa dang I brten pa bde chen ni hzhi pa 'i gnus skabs (p.293:7) sbyod byed yin la I de gnyis rdul dang dre ma ma Ius par zad pa las rgyu mthun pa 'i mtshan nyid do I I de ni lam gyi mi 'gyur ba'i bde chen gyis kyang gong gi mtha' bzhi dang bral bar rigs 'dra ba ite I der ma zad bde pa 'i rigs 'dra ni dngos dang sa (p.294: 1) bon ci rigs kyi sgo nus gzhi dus su yang yod de I des longs sku dang 'di gnyis kyi khyad par yang shes par nus te I de 'i stong gzugs kyi cha yod kyang bde chen yul yul can shas mi ehe bas so I I de Ita na sku 'di ni ma ning ngo I zhes grub bo I I 'dir lhan cig skyespa'i (p.294:2) sku ni bsampa'i cha nas ranggi donphun sum tshogspa'ol I snga ma mtha' dag gis gnyis ka min pa 'ang min pa ngos 'dzin pa ni tshig dngos su 'gal ba smra zhing don gang yin ma shes la I 'dzag pa 'i cha bco lnga pa min pa dang I bcu drug pa nyams pa min pa ni (p.294:3) 'dzag bde'i cha bcu drug pa ste I de yang min pa zhes pa'i don du bya (Bu-ston: rang dol sogs) dgos par mngon te da dung dpyad par bya '0 I I gnyis pa la gnyis I mtha' eung zad dpyad pa dang I tshig gi don no I I dang po ni I gal te 'dir ehos sku gzhan don phun tshogs dang I de la (p.294:4) shes pa dang shes bya gnyis su phye ba'i shes bya stong gzugs chos skur bzhag cing stong gzugs de nyid kyang thabs su byas pa dang I 'dzin pa ye shes shes rab tu gsungs pa 'di dag ni shin tu mi rigs te I rgyud dang 'grel pa 'i gong 'og mams su ehos sku rang (p.294:5) don phun tshogs dang stong gzugs gzugs sku dang shes rab kyi phyogs dang I 'dzin pa bde ba chen po 'i ye shes thabs su Ian cig ma yin par gsungs pa mams dang dngos su 'gal ba 'i phyir ro dang de Itar gsungs pa de dag gi don rigs pas 'grub pas 'dir (p.294:6) bshad pa 'di dag la rigs pa yang dag gis gnod pa 'i phyir dang I phyogs de gnyis ka khas blangs pa na 'bras ba'i mam gzhag 'ehol bar 'gyur ba'i phyir ro zhe na I bden mod kyi de la snga ma kha cig (dol 'brang) I don dam 'gal 'du skyon med la thabs gang yin pa de nyid shes (p.294:7) rab la sogs pa yin pa 'i phyir pan tshun ldog ste gnas pas sngar bstan pa mams dang brjod tshul mi mthun yang skyon med do zhes zer ro I I ka ye shes pa can dag khyod cag 'bras dus su rang rigs kyi thabs shes mi rung bar 'dod pa mi rigs te I don ngan (p.295:1) 'gal 'du skyon med yin pa 'i phyir thabs kyis thabs la 'khyud pa dcmg de las ldog pa yang ci'i phyir mi smra

Zhang-zhung Chos-dbang grags-pa, p.290:7 - 297:2 in mKhas-grub-rje, dGe-legs-dpalbzang-po. The Collected Works of mKhas-gnlb-rje , vol.S, 1983:161-623 (This is the commentary on KCT V:89 and the commentary on that verse VP V.2.).

203

APPENDIX 2. Table of Contents of the KCT and the Vimalaprabhii. In. order to obtain a more systematic knowledge of the content of the two basic texts of Ktilacakra, I present a translated Table of Contents of the KCT and the Vimalaprabhti.

I. The Sri Kiilacakra-tantra-riija (KCT). The KCT consists offive chapters in the following order: 1.Lokadhiitupatala, "The outer world chapter." 2. Adhyatmapa!ala, "The inner world chapter." 3. Abhi~ekapa!ala, "The initiation chapter." 4. Siidhanapatala, "The siidhana chapter." 5. Jiiiinapa!ala, "The knowledge chapter." II. The Vimalaprabhii. This text is also divided into five chapters in the same way as the KCT, although it also includes a division; mahti-uddeia ("great brief accounts). To organize and translate this infonnation is a necessary step, not done previously, in order to obtain an overview of the contents of the texts and teachings of Ktilacakra. The Vimalaprabhti commentary also reproduces the text of the KCT.

1. Lokadhiitupatala. Skt. VP I 1986:1-156, IASWR ed. p.1 - 89b; Tib. Toh.1347 Nyingma/Derge ed., vo!.40, p.943-1171; Peking 2064, p.121-1-1 to 1745-5; VP and Bu-ston's commentary, Bu-ston 1965a:301-603. 956 English trans!. by Newman 1987a:221-654. lst mahoddesa: sakalamtiravighnavintiSatafJ parame~tadevattifJ sanmtirga niyamoddeiafJ prathamafJ. "The brief account that destroys all devils and obstructors: The precept on the supreme chosen deity and the noble path." Skt VP I 1986:1-11; Trans!. Newman 1987a:221-244 2nd mahoddeSa: abhidheytibhidhtinasaTllbandha prayojanaprayojana saTflvik~yabhagavatas tantradesanoddeia6 dvitfyafJ. "The Bhagavtin 's teaching of the tantra, having observed the subject, the discourse, their relation, the purpose, and the ultimate purpose." VP I 1986:12-22; Newman 1987a:245-291. 3rd mahoddesa: deiakiidtidhye~akamiilatantralaghutantra sambadhoddeiafJ trtiyafJ. "The relationship between the teacher and the requestor, and the Root Tantra and the Abridged Tantra." VP 11986:22-30, Newman 1987a:292-316. 4th mahoddesa: sarvajiietytidinti tantrartijadeiaka adhye~akastidhanoddeiafJ caturthafJ. "Establishing the teacher and the requestor of the Tantra-rtija (King of Tantra) by means of "The Omniscient One, and so forth." VP 11986:30-42; Newman ... I nonnally use Bu-ston 's text as it is almost always identical with the canonical text, and it is useful to have the commentary and the text in one place.

204

1987a:317-366. [In the beginning of this uddesa the commentary to KCT I: 1 begins. The fonner three uddefas have been a sort of introduction to the whole tantra]. 5th mahoddesa: defakiidisalpgrahoddesaJ:t pancamaJ:t. "A summary of the teacher and so forth." VP 11986:42-46; Newman 1987a:366-384; (A continuation of the commentary on the KCT I: 1) 1st subchapter: A summary of the Vajrayoga. Newman 1987a:366-381. 2nd subchapter: A summary of the Dhanna teaching. Newman 1987a:381-382. 3rd subchapter: A summary of the purpose and the ultimate purpose. Newman 1987a: 382-384. . 6th mahoddesa: malJtjalabhi:fekiidisarrzgrahoddefaJ:t saethaJ:t. "A summary of the malJtjalas, initiations, and so forth." VP 11986:47-52; Newman 1987a:385-412. A commentary on KCT 1:2. 7th mahoddesa: lokadhatusarrzgrahoddesaJ:t saptamaJ:t. "A summary of the cosmos." VP 1 1986:52-65; Newman 1987a:413-470. A commentary on KCT. 1:3-9 (KA) subchapter: prativacanasarrzgrahoddefaJ:t. "A summary of the reply [of the Sakyamuni Buddha.]" VP 11986:52-53; Newman 1987a:413-419. A commentary on KCT. I:3. (KHA) subchapter~ lokadhiitusarrzgrahoddesaJ:t. "A summary of Cosmos (Lokadhatu)." VP 11986:53-55; Newman 1987a:419-426. A commentary on KCT. 1:4. (GA) subchapter~ vajrakiiyasarrzgrahoddefaJ:t. "A summary of the Vajrakiiya." VP 11986:55-56; Newman 1987a:427-432. A commentary on KCT. 1:5 (GHA) subchapter~ rahvadyutpiidasaT,tgrahoddesaJ:t. "A summary of the origin of Rahu and so forth." VP 11986:57-58; Newman 1987a:433-441. A commentary on KCT 1:6-7. (NGA) subchapter~ candrakaladivisvamantrasarrzgrahoddesaJ:t. "A summary of all the mantras - the digits of the moon and so forth." VP 1 1986:58-64; Newman 1987a:442-466. A commentary on the KCT. I: 8. (CA) subchapter~ svaralJarrzjanmasthananirdefaJ:t. "A specification of the places of birth of the vowels." VP I 1986:64-65; Newman 1987a:466-470. A commentary on the KCT. I:9, 8th mahoddesa: lokadhiitumanasarrzgrahoddesaJ:t a:ftamaJ:t. "A summary of the measurements of the cosmos," VP 11986:65-76; Newman 1987a:471-530. A commentary on the KCT.I:I0-25. 9th mahoddesa:jyotijnanavidhiniyamamahoddesaJ:t. "The fonnula for knowing astronomy." VP 11986:77-123; Newman 1987a:531-542 (Newman's translation ends with the commentary on KCT. 1:26-27). A commentary on the KCT.I:26-94, There exists a translation to Gennan of this part of the KCT, without the commentary VP, by BaneIjee 1959:58_136 957 . 10th mahoddesa: svarodayayantravidhiniyamamahoddesaJ:t, "The precept on the procedure for the Svarodaya 958 and the machines (yantra)." VP I 1986: 123-152; Newman BaneIjee, 1958:58-136. Svarodoya "describes various arrangements (cokras) ofletters associated with time division and astrological entities, magical pictures of animals and objects (also called cakro), and arrangements 957

95.

205

1987a:543-577 (Newman here translates only the commentaries to the verses in KCT. I:128-149.) A commentary on the KCT. I:95_149. 959 11th mahoddesa: mlecchadharmotpatabuddhadharmaprati~thapanadi. "The eradication of the mleccha-dharma and the establishment of the Buddha-dharma and so forth." Verses 150-170 from the KCT. There is no commentary in the. Vimalaprabha on these verses. The Vimalaprabha states only: "Now, the great cakravartin's eradication of the barbarian dharma, his establishment of the Buddhadharma, and so forth, is easily understandable; therefore, it will not be mentioned in the commentary.,,960 (The verses treat the eschatology of the Kalacakra, the coming war between the kings of Sambhala and the Mlecchas, that is the Muslims.) VP I 1986: 152-156; Newman 1987a:578-654. 2. The Adhyiitmapataia. Sanskrit: Vimalaprabhii VoU 1986:157-272 and IASWR ed. p.94 A to 172 B 1; Tibetan: Nyingrna/Derge Toh.1347, vo!.40, p.lI72-1337; Peking 2064, vo146, p.l74-56 to 215-1-1 (fo1.131b 6 -227a5); VP and Bu-ston's commentary, Bu-ston 1965b:I-229. English trans!. by Wallace 1995: 143-474. French trans!. by Stril-Rever 2000: subchapt.! 68-94, subchapt.2 119-147, subchapt.3 179-196, subchaptA 227-274, subchapt.5 297-327, subchapt.6 355-407. 1st mahoddesa:(IASWR ed.p.94A:) kiiyavakcittotpattidulJkha marga samudayanirodha satyanin:zaya mahoddesalJ prathamalJ. (Upadhyaya:) kiiyavakdttotpatticaturaryanirlJaya-mahoddesalJ. "The emergence of body, speech and mind, and the investigation of the four noble truths." A commentary on KCT. II: 1-26; VP I 1986:157-170; Bu-ston 1965b: 1-28:6; Wallace 1995:143-182. 2nd rnahoddesa: samudayasatyadimahoddesalJ dvitryalJ."The truth of the emergence of all [the factors of existence of the human beings]." A commentary on KCT.II:27-47; VP I 1986:170-183; Bu-ston 1965b:28:6-52:6; Wallace 1995:183-219. 3rd mahoddesa: adhyatmani cakravarttimlecchayuddha kiilacakrakulatantra naq.fkulotpatti mahoddeialJ trayalJ. "The emergence of the naq.fs, of the fight between the cakravartin and the mleccha and the tantra of the family of Kalacakra." A commentary on the KCT.II: 48-60; VP I 1986:183-190; Bu-ston 1965b: 52: 6-68:2; Wallace 1995:220-243. 4th mahoddesa: ari~!amaralJalak~ana naljfcchede mahoddesalJ caturthalJ. "Fatal signs of death, and the ramification of the naq.fs." of nak~atras , months and numbers relative to the directions (bhiimis). All of which promote military victory to their user." (Pingree. 1981 :77). The verse KCT 1:149 is verse 148 in the Tibetan translation by Bu-ston and in the translation by Banerjee in his dissertation (Bu-ston. 1965a:38; Banerjee. 1959:205). The whole of chapter I has one verse less in both editions. 960 Vimalaprabhii voL!. 1986:152; Newman. 1987a:578. This is an understatement, as these verses are not at all easy to understand. They have been commented upon by Bu-ston in his commentary to the KCT and by later Tibetan commentators and translated by Newman and Banerjee. 959

206

A commentary on KCT.II: 61-81. VP I 1986:190-214; Bu-ston 1965b: 68:2-127:2; Wallace 1995:244-312.

5th mahoddesa: lokasamvrttyotpadanirodhahetubhiita ~a1Jala~a1Ja kiilacakraniyama mahoddesalJ. pancamalJ.. "The definition of the characteristics of the momentary in the Kiilacakra." A commentary on KCT.II: 82-106; VP I 1986:214-227; Bu-ston 1965b: 127: 2-155:6; Wallace 1995:313-358. 6th mahoddesa: rasayanadibalatantra mahoddesalJ. ~a~!halJ.. "Alchemy etc. and the

pediatrics-tantra." A commentary on KCT.II:I07-160; VP 11986:228-255; Bu-ston 1965b:155:6-197:6; Wallace 1995:359-475. Of note here is that in Bu-ston's text and the canonical edition of sDe-dge (Dharma ed.), the commentary applies to verses KCT.II: 107-154, but verse 154 corresponds to verse 160 in the Sanskrit text. Consequently, as in the fore-going mahoddesa, counting the verses corresponding between the Tibetan and Sanskrit texts, it must be that somewhere between verses 107-154 in the Tibetan text, 6 verses have been excluded by the Tibetan translators or by later editors of the canonical texts. 961 The verses excluded in the Tibetan edition are verses 116-121 as noted by Fennerin his dissertation on alchemy in the Kalaeakra Tantra. 962

7th mahoddeSa: svaparadarsananyayavieara mahoddesalJ. saptamalJ.. "Arguments for own and other kinds of philosophies." A commentary on KCT. II:161-180; VP I 1986:255-271; Bu-ston 1965b: 197:6-229. In agreement with what has been stated above the text by Bu-ston ends with verse 174.

3. The Abhiljekapatalal;i. Skt.IASWR ed. fo1.162a l -250b ll ; VP II i994:1-248. Tib.: Toh.1347 Nyingma/Derge ed. vo!.40, p.1338-1456; Peking 2064, vo!.46, 215-1-1 to 257-4-3(fol.1-103b 2);963 VP and Bu-ston's commentary, Bu-ston 1965b:231-473.

lst mahoddeSa: Skt: vajraearyadi sarvakamaprasara sadhanala~a1Ja mahoddeso abhi~ekapa!ale prathamalJ..

Tib: sLob-dpon la-sogs- pa dang las rab- 'byam thams-ead-kyi sgrub-thabs kyi mtshannyid kyi mdor-bsdus chen-po. Trans!., "The characteristics of the sadhanas of the complete diffusion [of the teachings] from the vajracaryas and others." A commentary on KCT.ID:1-22. Skt.IASWR fo1.162aL172b 1; Vp II 1994:1-21; Tib. Peking 2064, vo!.46, 215-1-1 to 222-4-8 (fol.1-16aB); Bu-ston 1965b:232 '-2673• 961 See also the edition of the KCT by Bu-ston. (Bu-ston. I 965a: Part I, 83 and 88; The Nying-ma edition Toh.362 and Toh.1346, where it is also clear that there are only 174 verses in the Tibetan translation. 962 See Newman. 1987a: 191-192 reviewing Fenner. 1979: 116-117. It is also noted by Banetjee. 1985:72, where he states that these verses are also missing in the Sanskrit Patna manuscript 963 I refer in what follows to the Peking edition of the bsTan- 'gyur for the 3'" and 4th chapters. For some reason, in the Derge edition the order of these two chapters has been reversed so that chapt. 3 in the Nyingma edition is the Siidhanapafaia and the fourth is the Abhi~ekapafala. That makes referencing difficult. The Peking print from the Otani university is generally of better quality than the Nyingma edition.

207

2nd mahoddesa: Skt: rak~iicakra-purviinga ma bhumyiidisarrzgraha mahoddesa so abhi~ekapatale dvitrya/}. Tib: bSrung-ba'i 'khor-lo sngon- du 'gro-ba-can sa la-sogs-pa gzung-ba 'i mdor bsdus chen-po. Transl: "The attributes of the guardian deities arranged in order, and the earth and so on." A commentary on KCT.III:23-35. Skt. IASWR fol.l72b 2-187a4 ; VP II 1994:21-43; Tib.Toh.1347 NyingmaJDerge ed. vo1.40, p.1338-1345; Peking 2064, vo1.46, 222-4-8 to 230-1-1 (fo1.l6a8-34b l ); Bu-ston 1965b:267 3-313 2 . 3rd mahoddesa: Skt. mm:u!alava(r)ltiina niima mahoddesas trtlya/}. Tib. dKyil- 'khor bri-ba ses-bya-ba'i. Transl.:"The drawing of the ma1J£jala." A commentary on KCT.III:36-70. Skt. IASWR ed. foI.187a 5-203a I2 ; VP II 1994:44-69; Tib. Peking ed. 230-1-1 to 236-3-4 (fo1.34b l -50b 4 ); Bu-ston 1965b:313 2 -353 3 . 4th mahoddesa: Skt. yiirrz ma1J£jaliibhi~eka mahoddeHi§ caturtha/}. Tib. dKyil- 'khor-du dbang-bskur-ba'i mdor bsdus chen-po. Transl."Initiation into the ma1J£jala." A commentary on KCT.III:71-103. Skt.IASWR ed. fo1.203b L 221b 1; VP II 1994:70-98; Tib. Peking ed. p.236-3-4 to 245-4-5 (foL50b4 -73b 5); Bu-ston 1965b:353 3-405 5 . 5th mahoddesa: Skt. prati~tha-ga1Jacakravidhiyogacaryii mahoddesa/} pailcama/}. Tib. Rab-tu gnas-pa dang tshogs-kyi 'khor-lo 'i cho-ga dang rNal- 'byor-gyi spyod-pa'i mdarbsdus chen-po. Trans!. "Consecration, ritual feast and yogic conduct." A commentary on K CT.III: 104-161. Skt. IASWR ed. fo1.221b l -240a I2 ; VP II 1994:98-131; Tib. Peking ed. p.245-4-5 to 253-1-5 (fo1.73b 5-92a5); Bu-ston 1965b:4055-451 6. 6th mahoddesa: Skt. mudriidr~tima1J£jala visarjanavlrabhojyavidhimahoddesa/} ~a~tha/}. Tib. Phyag-rgya dang Ita stangs dang dkyil- 'khor gshegs-su gsol-ba dang dPa'-bo 'i stan-ma 'i mdor bsdus chen-po. Trans!. "Mudrii and lta-stangs 964 and a request for going to the ma1J£jala and a vidhi(ceremony) of reverence for the heroes." A commentary on KCT.III:162-203. Skt. IASWR ed.fo1.240b L 250b 11 ; vp II 1994:131-148; Tib. Peking ed. p.253-1-5 to 257-4-3 (fo1.92a5-103b 3). Bu-ston 1965b:451 6-473 7 .

4. The Siidhanapatalal;1. Skt. IASWR ed. fo!.251aL312a6 ; vp II 1994:149-241; Tib.: Toh.1347 Nyingrna/Derge ed., vo1.40, p.l457-1646; Peking 2064, vo!.46, p.257-43 to 282-4-3(fol.l03b 3-166a3); VP and Bu-ston's commentary, 1965b:476-623. 1st mahoddesa: Skt. sthiinarak~ii piipadisaniidi. Tib. gnas-bsrung sdig-bshad la-sogs. Trans!. "Explication of protectory and terrifying divinities, etc." A commentary on KCT.IV:I-7. Skt. IASWR ed. fo1.251a L 254b 3; VP II 1994:249-254; Tib. Toh.l347 Nyingma/Derge, vo1.40, p.1457-1482; Peking 2064, p.257-4-3 to 259-2-7 (foI.l03b 3 -107b 7). Bu-ston . 1965b:476L4866 .

964 In Tibetan this means a powerful look employed in order to subdue demons, a method used in tantric practise.

208

2nd mahoddesa: Skt: utpattikramena kiiyani~patti. Tib. skyed-pa'i rim-pas sku rdzogspa. Trans!."The perfection of the body by the generation stage." A commentary on KCT.IV:8-49 and half of 50. Skt. IASWR ed. fo!.254b 4-268b9.; VP II 1994:155_178; Tib. Peking 2064 Vo!.46, p.259-2-7 to 266-1-5 (fo1.107b 7-124b 5). Bu-ston 1965b:486 6-523 5 . 3rd mahoddesa: Skt. priiIJadevatotpiida. Tib. srog dang lha skyed-pa. Trans!. "The generation of living beings and gods." A commentary on KCT.IV:second half of 50109. Skt. IASWR ed. fo!.269a L 283b 8; vp II 1994:178-204; Tib. Peking 2064 Vo1.46, p.2661-5 to 272-1-5 (fo1.124b 5-139b 5). Bu-ston 1965b:523 5-559 3 . 4th mahoddesa: Skt. utpatyutpannakrama-siidhana. Tib. sKyed-pa 'i rim- pa dang rdzogs-pa 'i rim-pa 'i sgrub-thabs. Trans!. "Siidhana of the generation stage and the completion stage." A commentary on KCT.IV:l10-133. Skt. IASWR ed. fo!.284a l -292b 8; VP II 1994:204-219; Tib. Peking 2064 vo!.46, p.2721-5 to 276-2-2 (fo1.139b 5 -150a2). Bu-ston 1965b:5593-588 4 . 5th mahoddesa: Skt. niiniisiidhana. Tib. sna-tshogs-pa 'i sgrub-pa 'i thabs. Trans!. "Various siidhanas." A commentary on KCT.IV: 134-234. Skt. IASWR ed. fo!.292b 9-312a6; VP II 1994:219-251; Tib. Peking 2064 vo!.46, p.2762-2 to 282-4-4 (fo1.150a2-166a4). Bu-ston 1965b:588 L 623 2 . (Note, the verses 191-230 are not commented on at all). V. The Jiiiina-pataJal}. "The chapter on wisdom." Skt. Vimalaprabha Vol.III 1994:1_156965 Tib. Toh.1347 Nyingma/Derge ed., yo!.40, p.1647-18 ... Peking 2064, p.282-4-4 to 3351-6(fo1.166a4 - 296b 5); Bu-ston 1965c:I-294.

1st mahoddesa: Skt. yoginftantriidispharalJamahoddesalJ. Tib. rnal- 'byor-ma 'i rgyud la-sogs-pa spro-ba'i mdor-bsdus chen-po. Trans!. "The spreading(energy?) of the yogini-tantras and others." A commentary on KCT.V: 1-88. Skt. VP III 1994:1-45; Tib. Peking 2064, p.282-4-4 to 295-3-5 (fo1.l66a4 -198a 5). Buston 1965c:I-80 1. 2nd mahoddesa: Skt. catulJkiiyiidisuddhinirlJayamahoddesalJ; Tib. sku-bshi la-sogspa 'i rnam-par dag-pa nges-pa'i. Trans!. "The real and very pure four bodies and others." A commentary on KCT.V:89-126. Skt. VP III 1994:45-59; Tib. Peking 2064, p.295-3-5 to 299-2-7 (foI.198a 5-207b 7). Buston 1965c:80Li0i3. 3rd mahoddesa: Skt. paramiik~arajfiiinasiddhirniima; Tib. mchog-tu mi- 'gyur-ba 'j yeshes grub-pa shes-bya- ba'i mdor-bsdus chen-po. Trans!. "The completion ofthe wisdom of the supreme unchanging." I did not have access to the Sanskrit text until late in my work. Before the publication ofVimalaprabha vol. 3., 1994, the only text that existed was the manuscript that Vimalaprabha vo1.3 is based on. It is the only complete manuscript that exists of chapter 5 of the VP, but it is written in an old Bengali script difficult to read. My solution was to read the text in Tibetan using the texts in Bu-ston. 1965c and then compare with the Sanskrit. 965

209

A connnentary on KCT.V:127. Skt. VP III 1994:60-103; Tib. Peking 2064 299-2-7 to 321-1-3 (fo!.207b 7-262a3). Bustan 1965c:10P-2167 . 4th mahoddesa: Skt. niinopiiyavineyamahoddefa/:t; Tib. thabs sna-tshogs-kyis 'dul-ba'i mdor-bsdus chen-po. Trans!. "The disciplining (viniiya) by various skilful means (upiiya)." A commentary on KCT.V: 128-247. Skt. VP III 1994:103-155; Tib. Peking 2064, p.321-1-3 to 335-1-6 (fo!.262a 3-297a 6). Bu-ston 1965c:2167 -292 6 . (Verses V:248-261 are not connnented upon).

APPENDIX 3. The commentarial texts on the Kiilacakra Tantra in the bsTan-'gyur.

Below are given the titles of the connnentaries to the Kiilacakra texts from the bsTan'gyur. I have included the Tohoku numbers from the sDe-dge edition of the Tibetan canon (Toh.), and also the numbers from the Peking edition (P.) Toh. 1348, P.2065 Srf-paramiirthaseva by Padma dkar-po (Pur;rj.arfka), 20 fols., trans!. by Somaniitha. Toh. 1349, P.2066. Srfmad-vimalaprabhii-tantriivatiirar;fviidiicala-hrdayiiloka, 52 fols., trans!. by bLo-gros brtan-pa. Toh. 1350, P.2067. Padminf-niima-pafijikii by Kiilacakramahiipiida, 148 fols., trans!. by Somaniitha. Toh. 1351, P.2068. ParamiirthasaT[lgraha-niima-sekoddefa-tfkii by Niiropa, 69 fols., trans!. by Dharmadhara and Crags-pa rgyal-mtshan. Toh. 1352, P.2069. Sekoddefatippar;fby Siidhuputra Srfdharanandana, 14 fols., trans!. by Vanaratna and gZhon-nu dpal. Toh. 1353, P.2070. Sekoddesatfkii-niima by Dus-kyi 'khor-lo, 27 fols., trans!. by Somaniitha and 'Bra Shes-rab grags. Toh. 1354, P.207!. Sekodde§apafijikii, 13 fols., transL by Bu-ston. Toh.1355, p.20n. Srf-Kiilacakratantrariijasekaprakriyii-vrtti by Diirika, 31 fo1s., trans!. by Shes-rab grags. Toh.1356, P .2073. Srf-Kiilacakracaturaizgasiidhana-niima by Dus-shabs-pa, 10 fols., translators Visvasrf, and Cyi-jo Zla-ba 'i 'od-zer. Toh.1357, P .2074. Srfmad-nak~atrama1Jrj.ala-siidhana-ekiidaSiiizga-niima by Kiilacakrapiida, 15 fo1s., trans!. by Somaniitha and Shes-rab grags. Toh.l358, P.2075. Srf-Kiilacakra-siidhana-niima by Siidhuputra, 24 fols., trans!. by Viiglsvaragupta and Chos-rab. Toh.l359, P.2076. Srl-Kiilacakra-mar;rj.ala-vidhi, by Siidhuputra, 38 fols., transL by Viigfsvaragupta and Chos-rab. Toh.1360, P .2077. Srf-Kiilacakra-mar;rj.ala-vidhi by Kiilapiida, 10 fo1s., trans!. by Vanisrf and Chings Yon-tan 'bar.

210

Toh.1361, P.2078. Srf-Kiilacakra-sahaja-siidhana by Kiilapiida, 2 fo1s., trans!. by Buddhasrfjiiiina and Byams-pa 'j dpal. Toh.1362, P.2079. Sri-Kiilacakra-lqalJa-sahaja-siidhana-niima by Lalitavajra, 2 fo1s., trans!. by Viigf.fvara and Rva Chos-rab. Toh. 1363. Srf-Kiilacakra-siidhana-yogapradfpa-niima by Maitri, 15 fo1s., trans!. by Dharmapiilabhadra and Sha-lu lo-tsa-ba. Toh. 1364, P.2080. ~a4ailgayoga-niima by VajrapiilJi, 4 fo1s., trans!. by Subhutisiinti and Ting-nge- 'dzin bzang-po. Toh. 1365, P.208l. Sri-kiilacakra-garbhiilarrzkjira-slidhana-niima by Bram-ze bSodsnyoms-pa (PilJ4o), 10 fo1s., trans!. by Bhadrabodhi and Gyi-jo Zla-ba'i 'od-zer. Toh. 1366, P.2082. Kiilacakropadesa by Kiilacakramahiipiida, 2 fo1s., trans!. by Buddhiikarabhadra and Gyi-jo Zla-ba'i 'od-zer. Toh. 1367, P.2083. ~a4ailgayoga-niima by Anupamaralqita, 10 foIs., trans!. by Vibhuticandra and Mi-mnyam bzang-po. Toh. 1368, P.2084. ~a4ailgayoga-tikii byNyi-ma'i dpal ye-shes (Ravisrfjiiiina), 9 fols., trans!. by Vibhuticandra. Toh. 1369, P.2085. Sri-kiilacakropadesa-suryacandra-siidhana-niima, 5 fo1s., trans!. by Vibhuticandra. Toh. 1370, P.2086. Jiiiinacalqu-slidhana-niima by Kiilaplida, 2 foIs., trans!. by Vibhuticandra. Toh. 1371, P.2087. Triyogahrdaya-prakiisa-niima by 'Jam-dpal rgyal-po grags (Maiijusririijayasas), 2 fo1s., trans!. by Somaniitha and 'Bro Shes-rab-grags. Toh. 1372, P.2088. ~a4ailga-yogopadesciby Kiilacakrapiida, 3 fo1s., trans!. by Somalliitha and 'Bro Shes-rab-grags. Toh. 1373, P.2089. Sri-kiilacakropadesa-~aif.ailgayoga-tantra-paiijikii-niima by Avadhutipa, 24 fo1s., trans!. by Candrakirti. Toh. 1374, P.2090. ~a4ailgayogopadesa by Cilupa, 1 fa!., trans!. by Samantasri and Rva Chos-rab. Toh. 1375, P.209l. Yoga~aif.ailga-niima by Siibarisvara, 2 fo1s., trans!. by Vibhuticandra. Toh. 1376, P.2092. Yogamiilii by rTsa-mi Sangs-rgyas grags-pa, 2 foIs., trans!. by Shesrabdpal. Toh. 1377, P.2093. Antarmaiijari-niima by Vibhuticandra, 12 fo1s., trans!. by Vibhuticandra. Toh. 1378. Hrdaya-vajrapiida-niima by Sabari-pa, 1 fa!., trans!. by Vanaratna and bSodnams rgya-mtsho. Toh. 1379, P.2094. Kiilacakra-vajrayiina-muliipatti by Bodhisattva. 2 fo1s. Toh. 1380, P.2095. Sri-kiilacakroddiina by Abhayakara, 2 fo1s., trans!. by Jo-bo Ri-pa (Parvata) and Khe 'u-gad 'Khor-lo grags, Toh. 1381, P.2096. Sri-kiilacakra-daTJr!aka-stuti-niima by Siidhukirti, 4 fo1s., trans!. by Vinaycirimitra and Tshui-khrims seng-ge. Toh. 1382, P.2097.

A~tii~takena-catu1;t~a~tiyogini-balividhi-niima,

4 foIs., trans!' by

Kirticandra and Grags-pa rgyal-mtshan. Toh. 1383, P.2098. Kiilacakriivatiira-niima by Abhayiikaragupta, 8 fo1s., trans!. by Abhayiikaragupta and Ding-ri Chos-grags. Toh. 1384, P.2099. Sri-kiilacakra-galJanopadesa-niima by Siikyasribhadra, 2 foIs.

211

Toh. 1385, P.2IOO. SiiryacandragrahalJa-galJita by Sakyasrfbhadra, I fo1. Toh. 1386, P.2IOI. Paiicagraha-prthaggalJanopadesa-nama by Sakyasrfbhadra, 3 fo1s. Toh. 1387, P.2ID2. $atjangayoga by Anupamara/qiia, 18 fo1s., trans1. by Vibhiiticandra and Mi-mnyam bzang-po. Toh. 1388, P.2103. GulJabharalJf-nama-iatjangayoga-fippalJf by Nyi-ma 'i dpal ye-shes (Ravisrfjiiana), 25 fo1s., trans1. by Vibhiiticandra and bLo-gros brtan-pa. Toh. 1389, P.2104. Sekoddesa-fippalJfby rNam-par-rgyal-ba dbang-po, 20 fo1s., transl. by dPang bLo-gros brtan-pa.

Toh. 1390, P.2106. Vajrapadagarbha-saTflgraha-nama by sakyasr~ 4 fo1s., transl. Sakyasrf and dPyal Chos-kyi bzang-po. This text is also known as $atjangayogopadesa. 966 Toh. 1391, P.2I07. Vajrapadagarbha-saTflgraha-nama-paiijikii by Sakyasrf, 3 fols., transl. by Sakyasrf and dPyal Chos-kyi bzang-po. This is an autocommentary to 1390. Toh. 1392, P.2108. Srf-kiilacakra-supratiifha-vidhiby Kalacakrapada, 5 fo1s., transl. by Vagfsvara andRva Chos-rab.

Toh. 1393, P.2109. Srf-kalacakra-galJacakra-vidhi by Kalacakrapada, 4 fo1s., transl. by Vagfivara andRva Chos-rab.

Toh. 1394, P.21IO. Sri-Kalacakra-homavidhi by Kalacakrapada, 4 fo1s., transl. by Vagfivara andRva Chos-rab.

'" Catalogue of the rNyingma edition. 1982 voI.3:185.

212

Abbreviations.. AA - Abhisamayiila/flkiira. CAl - Central Asiatic Journal. KCT - Paramiidibuddhoddhrta-Sri-Kiilaeakra-niima-tantra-riija (the laghutantra) Toh.362, 1346. Editions by B. Banerjee 1985 and in the Vimalaprabhii editions 1986, 1994 and 1994. VP - Vimalaprabhii-pkii Toh. 1347 VP vol.I, VP vol.II and VP vol.ID - The corresponding Sanskrit editions of the Vimalaprabhiitikii from 1986, 1994 and 1994. MNS - Maiijusri-niima-sahgiti Toh. 361 Nyingrna ed. - Nyingrna 1982 P. = Otani - The Tibetan Tripitaka1962 Toh. - The Tohoku Catalogue 1934 * A sign for a word in Sanskrit which is reconstructed from the Tibetan.

BIBLIOGRAPHY.

1. Sources in Sanskrit and Tibetan.

AbhayakaragUpta. 1949. Nifpannayogiivali ofMahiipalJtf.ita Abhayiikaragupta. Ed. by Benoytosh Bhattacharyya, Gaekwad's Oriental Series no. 109, Sanskrit text on p.8393; English transl. p.76-86 [Iritroduction on the deities in the KalacakramaJ;lc;!ala]. Baroda. Abhinavagupta. 1922. The Tantriiloka ofAbhinavagupta - with Commentary by Rajanaka Jayaratha (The chapter on KiilalTime - chapter 6.) Kashrniri Series of Texts and Studies 36. Abhisamayiila/flkiira-iiloka. 1932-35. By Haribhadra. Ed. by U. Wogihara. Tokyo. Aryamaiijusriniimasa/flgiti with AmrtakalJ.ikii-fippalJ.i by Bhilqu Ravisrijiiiina and AmrtakalJ.ikodyota-nibandha of Vibhiitieandra. Ed. by Banarsi Lal. Central

Iristitute of Higher Tibetan Studies. Samath, Varanasi 1994. Avadhiitayoga-niima-iidibuddha-siidhana, by Kiilacakrariiti-pa. Trans!. by Kiilacakra, the

Younger and rTsa-rni Sangs-rgyas grags-pa. The Tibetan Buddhist Canon. P. 4612; Toh.4532. Beom ldan 'das dpal dus kyi 'khor 10 'i ehos 'byung ngo mtshar rtogs brjod. Paris: Musee Guimet (#54588), incomplete manuscript, 52 fols.

·213

Bod-rgya tshig-mdzod chen-mo, 3 vols. 1985. Beijing. (Tibetan-Tibetan-Chinese Dictionary). Bu-ston.1965. The Collected Works ofBu-ston. Part 1-5 (KA- CA) Sata-Pitaka Series 4145. Ed. by Lokesh Chandra, (Bu-ston's edition and commentary on the SrI Kiilacakratantra-riija and on the Vimalaprabhii and other Kiilacakra works.) New Delhi. - 1965a. "Annotations to the Sri Kiilacakra-tantra-riija." p.I-299 and "Annotations to the Vimalaprabhii, Chapter 1 - Lokadhiitu-patala." p.301-603. The Collected Works ofBu-ston, Part 1 (KA) Ed. by Lokesh Chandra, New Delhi. - 1965b. "Annotations to the Vimalaprabhii, Chapter 2-4: Adhyiitrna-patala." p.1230; Abhi~eka-patala, p.231-474; and Siidhana-patala, p.475-624. The Collected Works ofBu-ston, Part 2 (KHA). Ed. by Lokesh Chandra, New Delhi. - 1965c. "Annotations to the Vimalaprabhii, Chapter 5, Jfiiina-patala." p.I-294. The Collected Works ofBu-ston, Part 3 (GA). Ed. by Lokesh Chandra, New Delhi. - 1965d. "Dus-'khor chos-'byung" The Collected Works ofBu-ston. Part 4 (NA) Ed. by Lokesh Chandra. New Delhi:I-92. dGe-shes Chos-kyi-grags-pas brtsams-pa'i brda-dag ming-tshig. Beijing. 1981 (1949). (Tibetan-Tibetan-Chinese Dictionary). Dol-po-pa. 1992. The 'Dzam-thang Edition of the Collected Works ofKun-mkhyen Dol-popa Shes-rab rgyal-mtshan. 7 vols. With an Introduction and Catalogue by Prof. Matthew Kapstein. Delhi. dPag-bsam ljon-bzang. 1908. By Sum-pa mkhan-po Ye-shes dpal-jo [written in 1748].Ed. by Sarat Chandra Das. Calcutta. 'Gos 10 tsa ba gZhon nu dpal. 1976. Deb ther sngon po. Ed. by Lokesh Chandra. New Delhi. Guhyasamtijatantra.193 I. Ed. by Benoytosh Bhattacharyya. Gaekwad's Oriental Series 53, Baroda. rJe blo-gros chos-skyong. 1983. "'Grel chen dri med 'od kyi rgya cher bshad pa de kho na nyid snang bar byed pa ches bya ba las ye shes kyi le'u'i 'grel bshad rje blo gros chos skyong gis mdzad pa la" [This is the commentary on the fifth chapter of the Vimalaprabhii by rJe blo-gros chos-skyong.] In The Collected Works ofMkhasgrub dge-legs dpaZ Vol.7. Gedan Sungrab Minyarn Gyunphel Series 120. New Delhi 1983:1-450. KtiZachakra. 2000. (An Iconographical description of the deities in the Kiilacakra Tantra by the monks of the Narngyal monastery). Roma. KtiZacakra-tantra and Other Texts. 1966. Ed. by R.Vira and L.Chandra. Satapitaka Series, vols. 69-70. New Delhi. KaZtiptivattira. P.5908, In The Tibetan Tripitaka, Peking Edition, 148:159-165. Edited byD.T. Suzuki. Tokyo-Kyoto 1957. Toh.4464. In the bsTan-'gyur, sDe-dge Edition. Sna-tshogs, vol.PO, fols.315b327a. In the Nyingma edition. Karar;lI!avyiiha. 1873. Edited by Satyavrata Siima§rarni. Calcutta 1873. (Ktira/Jr!avyiiha in Tibetan translation. Toh.116). Klong rdol bla rna. 1973. Edited by Lokesh Chandra. Dus 'khor 10 rgyus: Klong rdol bla

214

rna Nga dbang blo bzang: Dang po 'i sangs rgyas dpal dus Icyi 'khor 10 rgyus dang ming gi mam grangs in The Collected Works ofLongdol Lama. Ed. by Lokesh Candra, New Delhi. Mahamiiyiitantram. 1992. Mahiimliyiitantram with Gunavati by Ratniikarasiinti. Ed. by S.

Rinpoche and V.Dwivedhi. Rare Buddhist Text Series 10. Central Institute of Higher Tibetan Studies, Samath,Varanasi. Mahiivairocana-sutra. Chikyo Yamamoto, Mahiivairocana-sutra. Translated into English by Chikyo Yamamoto. New Delhi 1990. Mahiivyutpatti. Part I and II. Ed by R. Sakaki 1972. Original edition: Kyoto 1916-26. (Editorial details in Japanese.) [This edition is in the possession of the Stockholm University Library.] Meisezahl, R.O. (ed). 1985. [Nyang Ral-pa-can:] Die grosse Geschichte des tibetischen Buddhismus nach alter Tradition - rNiIi.-ma'i chos-bYUli chen-mo. [Monumenta Tibetica Historica, Abt. 1, Bd. 31]. Sankt Augustin. Mi-pham. 1971. Mi-pham on the Kiilacakra Tantra. VoU Gangtok 1971. Mkhas-grub-rje. 1983. The Collected works ofMkhas-grub dge-legs-dpal, New edition: Gedan Sungrab Minyam Gyunphel Series 120. New Delhi 1983. Nyingrna. 1982. The Nyingma edition of the sDe-dge bKa'- 'gyur and bsTan-gyur. Oakland 1982. Padma dkar-po 19 Tibetan Chronicle. Ed. by Lokesh Chandra. Sata-Pitaka Series 75. New Delhi. Rva Lo-tsa-ba rDo-rje-grags rNam-thar. The Lives of two Esotheric Adepts. The rNamthar of Rwa Lo-chen Rdo-rje-grags and Thar-pa 'i rgyal-mtshan. Ed. by Ngawan Gelek Demo. Gedan Sungrab Minyag Gyunphel Series, Vol. 59 New Delhi 1974, p.l301. Another edition ofthe same work is: mThu stobs dban phyug rj~ brtsun. Rva Lo-tsa-ba'i mam par thar pa. Ed. byVen. Dii Lama, Delhi 1965. The Nyingma edition ofthe sDe-dge bKa' 'gyur/bsTan- 'gyur. Research Catalogue and Bibliography, Vol. 1-8. VolUIne 1":' Comparative Tables of Editions, p.I-93. VolUIne 8 - Sanskrit Manuscripts, Piili Texts, Bibliography, Indexes. p.I-193. Rigzin, Tsepak. 1986. Tibetan-English Dictionary of Buddhist Terminology. Dharamsala. Rin-chen-bzang-po. 1977. rNam thar shel phreng lu gu rgyud. Collected biographical material about Lo-chen Rin-chen-bzang-po and his subsequent reembodiments.

No.3. Delhi. Sekoddesatikii. 1941. Ed. and with an introduction by Mario Carelli, Gaekwad's Oriental Series 90, Baroda. Sri Kiilacakratantra-rlija. 1985. Ed. by Biswanath Banerjee. Calcutta. Tiiraniitha. 1983. "Dpal dus kyi 'khor lo'i chos bskor gyi byung khungs nyer mkho," In The Collected Works ofJo-nang rje-btsun Tiiraniitha, vol.2, pp.I-43. - Smanrtsis shesrig Dpemdzod. Leh. The History ofthe Monastery ofZhwa-lu - being the texts of the Zhwa lu gdan rabs and the Autobiography. By Zhwa-Iu-Ri-sbug SpruI-sku Blo-gsal-bstan-skyong. Ed. by

Tashi Yangphel Tashigang. Leh 1971. The Tibetan Tripitaka. Peking edition.(P) Kept in the library of the Otani University.

Reprinted under the supervision of the Otani University, Kyoto. Ed. by D.T. Suzuki. Catalogue and Index (1 voL). Tokyo 1962. (Reprint Kyoto 1985).

215

Tohoku Catalogue (Toh.). 1934. A Complete Catalogue of the Tibetan Buddhist Canons (Bka'-'gyur and Bstan-'gyur), 2 vols., Ed. by H.Ui, M.Suzuki, Y.Kanakura, T.Tada. Tohoku Imperial University, Sendai 1934. (sDe-dge edition) Vimalaprabhii. Microfiche edition MBB-1971-24 at the Institute for Advanced Study of the World Religions (IASWR), New York, fol.1-312a6. Vimalaprabhiitfkii 1. 1986. (VP I) Vimalaprabhatfkii ofKalki Srf PUI}r!arika on Srf Laghukiilacakratantrariija by Srf Mafijusrfyasa [Vol. 1.]. 1986. Critically Edited & Annotated with Notes By Jagannatha Upadhyaya. Sarnath, Varanasi: Central Institute of Higher Tibetan Studies. Vimalaprabhiitfkii II. 1994. (VP II) Vimalaprabhiitfkii ofKalkin SrfpUlJr!arika on Srilaghukiilacakratantraraja by SrfMaiijusrfyasas. [VoI.II] Ed. by Samdhong Rinpoche. Rare Buddhist Text Series -12. Samath, Varanasi 1994: Central Institute of Higher Tibetan Studies. Vimalaprabhiitfkii III. 1994. (VP III) Vimalaprabharfkii ofKalkin SrfpUl:zr!arika on Srflaghukiilacakratantrariija by SrfMafijusrfyasas. [Vo1.III]. Ed. by Samdhong Rinpoche. Rare Buddhist Texts Series -13. Samath, Varanasi 1994: Central Institute of Higher Tibetan Studies. Zhang-Zhung Chos-dbang grags-pa. 1983. "Nges mdzad pa'i 'grel chen dri med 'od kyi rgya cher bshad pa de kho na nyid snang bar byed pa las ye shes kyi le'u'i 'grel bshad la" [This is the commentary on the fifth chapter of the Vimalaprabhii by Zhang-zhung Chos-dbang grags-pa,] In: The Collected Works ofMkhas-grub dgelegs dpal, Vo1.5. Gedan Sungrab Minyam Gyunphel Series 120. New Delhi 1983, p.161-626.

2. Literature in other languages.

Abegg, Emil. 1928. Der Messiasglaube in Indien und Iran. Berlin und Leipzig. Andresen, Jensine. 1997. Kalacakra - Textual and Ritual perspectives. Unpublished Phil.Dr. Dissertation. Harvard University. Cambridge, Massachusetts. Aris, Michael & Aung San Suu Kyi, eds. 1980. Tibeten Studies in Honour ofHugh Richardson. Warminster. Avalon, Arthur (Sir John Woodroffe). 1953. The Serpent Power. Madras. Bailey, Alice. 1974 (1951). Esoteric Astrology. VolumelII - A Treatise on the seven Rays. New York. Bandyopadhyaya, Biswanath. 1952. "A note on the Kalacakratantra and its commentary." Journal of the Asiatic Society ofBengal 18 (1952), p.71-76. Bareau, Andre. 1967. "Le sti'ipa de Dhiinyakataka selon la tradition tibetaine." Arts Asiatiques 16 (1967), p.81-88. Banerjee, Biswanath. 1959. aber das Lokadhiitu parala. 1. Kapitel des LaghuKalacakratantra-raja. Dr.Phil. Dissertation. Der Universitat zu Munchen. 1981. "Trends in the Development of Buddhism." Aspects ofBuddhismSilver Jubilee Comemoration Volume of the SRlTOBS. Delhi:80-86.

216

1999. "The Kiilacakra School: The latest phase of Buddhism". In Tantric Buddhism - Centennial Tribute to Dr. Benoytosh Bhattacharyya. Ed. by N.N. Bhattacharyya. Delhi: 263-267. Batchelor, Stephen. 1987. The Tibet Guide. London. Beckwith, C.1. 1980. "The Tibetan Empire in the West." in Tibetan Studies in Honour of Hugh Richardson. Warrninster:30-38. Beguin, Gilles. 1978. "Un grand mandala de Kiilacakra au musee Guimet." In La Revue du Louvre et des musees de France, No.2 (1978):113-121, Paris. - 1981. Les mandala himiilayens du musee Guimet. Paris. Berglie, Per-Arne. 1983. Gudarna stiger ned. - Rituell besatthet hos sherpas och tibetaner. Stockholm. Beltz, Johannes. 2001. Mahar, Bouddhiste et Dalit. Conversion religieuse et emancipation sociopolitique dans l'Inde des castes. Bem. Bernbaum, Edwin. 1980. The Way to Shambhala. Garden City, New York. - 1985. The Mythic Journey and its Symbolism: A Study of the development of Buddhist Guidebooks to Shambhala in relation to their Antecedents in Hindu Mythology. Dissertation for the degree of Doctor of Philosophy at University of California. University Microfilms International, Ann Arbor. Bharati, Agehananda. 1961. "Intentional Language in the Tantras." Journal of the American Oriental Society 81 (1961), p.261-270. Bhattacharyya, Benoytosh. 1923. "Buddhist Iconography. - Vajradhara vs. Vajrasattva." The Journal of the Bihar and Orissa Research Society. Vol.IX (1923):112-117. 1929a. Two Vajraylina Works. Baroda. 1929h. "A peep into the Later Buddhism". Annals ofthe Bhandarkar Oriental Research Institute, Poona. Vo1.10,apriI1929:1-25. 1958. The Indian Buddhist Iconography. Calcutta. 1967. Guhyasamiijatantra. Gaekwad's Oriental Series 53, Baroda 1967. Bhattacharyya, N.N. 1982. A History of the Tantric Religion. Delhi. Braarvig, Jens. 1993. The A~ayamatinirdeSasiitra. YoU, "Edition of extant manuscripts with an index." Vol.II, "The Tradition of Imperishibility in Buddhist Thought". Oslo. Brauen, Martin. 1997. The Mandala. Sacred Circle in Tibetan Buddhism. (German ed.l992). London. & Peter Hassler. 1997. "Computer Aided 3D-Animation of the Kiilacakra Mal)c;iala." Tibetan Studies. Proceedings of the International Association for Tibetan Studies (pIATS), Graz 1995, Vol.I, Ed. by Helmut Krasser, Michael. Torsten Much, Ernst Steinkellner, Helmut Tauscher. (Osterreichesche Akademie der Wissenschaften, Philosophisch.historische Klasse. Denkschriften, 256. Band) Wien:77-81. 2000. Traumwelt Tibet - Westliche Trugbilder. Bern - Stuttgart - Wien.

217

Broido, Michael M. 1988. "Killing, Lying, Stealing, and Adultery: A problem of Interpretation in the Tantras. - Part I: Killing, Lying, Stealing, and Adultery in the Kalacakratantra." In Buddhist Hermeneutics. Ed. by Donald S. Lopez. Studies in East Asian Buddhism 6, Honolulu. Bronkhorst, Johannes. 2003. "L'expression du moi dans les religions de l'Inde." Revue de l'historie des religions, 220.1 Janvier-mars 2003. Brough. 1948. "Legends ofKhotan and Nepal". Bulletin of the School of African and Oriental Studies, Vo!' 12 (1948). Bryant, Barry. 1992. The Wheel of Time Sand Mandala. Visual Scripture in Tibetan Buddhism. San Francisco and New York. Buck, Stuart H. 1969. Tibetan-English Dictionary. Washington D.C. 1969. Bumouf, Eugene. 1876. Introduction a l'histoire du Bouddhisme Indien. Paris. 1852. Le Lotus de la Bonne Loi. Paris. Bu-ston 1964. History ofBuddhism 2. Trans!. by E. Obermiller, Heidelberg 1932 (lst ed.) Tokyo. Cairns, Grace E. 1992. Man as Microcosm in Tantric Hinduism. New Delhi. Chandra, Lokesh. 1965. Preface to the Collected Works ofBu-ston, Part 1. New Delhi 1996. Transcendental Art of Tibet. Sata-Pitaka Series, Indo-Asian Literatures Vol. 385. New Delhi:73-80, 188-189. Chattopadhyaya, Alaka. 1967. Atisa and Tibet. Calcutta. Chattopadhyaya, Sudhakar. 1962. The evolution of theistic sects in ancient India up to the time of Sa/{lkariiciirya. Calcutta. A Complete Catalogue of the Tibetan Buddhist Canons (Bkha '- 'gyur and Bstan- 'gyur). Derge edition. Ed. by Hakaju Ui, Munetada Suzuki, Yensho Kanakura and Tokan Tada. Tokyo 1934. [Tohoku Catalogue (Toh.)]. Choedon, Yeshi. 2002. "Issues of Tibetan Nationalism and National Identity." In Tibet. International Associationfor Tibetan Studies, Leiden 2000. Ed. by Henk Blezer, Leiden 2002. Cicuzza, Claudio. 2001. The Laghutantratika by Vajrapani. Serie Orientale Roma 86. Roma. Conze, Edward. 1954. Abhisamayiila/{lkiira. Roma. Cordier, Palmyr. 1909. Catalogue du Fonds Tibetain 2. Paris. Cozort, Daniel. 1986. Highest Yoga Tantra. - An Introduction to the Esoteric Buddhism of Tibet. Ithaca, New York. Csoma de Karas, Alexander. 1833. "Note on the origin of the Kala-Chakra and AdiTibetan Studies. Collected Works of Alexander Csoma de Karas, 4. Budapest 1984, p.21-23; Repr. inJASB 28 (1986), p. 108-11 1. 1834. A Grammar of the Tibetan Language in English. Calcutta. Dalai Lama, His Holiness the. 1981. Concerning the Kalachakra Initiation in America. Translated by L.T.Doboom Tulku and Glenn H. Mullin. Madison, Wisconsin. 1985. The Kalacakra Tantra. - Rite ofInitiationfor the Stage of Generation. A Commentary on the text of Kay-drup-ge-Iek-bel-sang-bo by Tenzin Gyatso, the Fourteenth Dalai Lama, and the text itself. Edited, translated and introduced by Jeffrey Hopkins. London. Damdinsiiren, C. 1981. "A Commentary on Kalacakra or Wheel of Time." The Tibet

218

Journal 6, no.l (1981): 43-49. Dargyay, Eva K. 1977. The Rise ofEsoteric Buddhism in Tibet. Delhi: MotHaI Banarsidass. - .1985. "The Concept of a "Creator God" in Tantric Buddhism." Journal ofthe International Association ofBuddhist Studies 8 (1985), p.31-47. Das, Sarat Chandra. 1976 (1903). A Tibetan-English Dictionary. Delhi. Dasgupta, Shashi Bhusan. 1974. An Introduction to Tantric Buddhism. 1st ed. 1950. Berkeley and London.s 1969 (1946). Obscure Religious Cults. Calcutta. Davidson, Ronald M. 1981. "The Litany of Names ofMafijusrL" Text and Translation of the MafijusnnfunasaIigiti. Melanges Chino is et Bouddhiques 20 (1981):1-69. 1995. "Atisa's A Lamp for the Path to Awakening." Buddhism in Practice. Ed. by Donald S. Lopez, Jr. Princeton, New Jersey:290-301. 1991. "Reflections on the Mahesvara Subjugation Myth: Indic Materials, Saskya-pa Apologetics, and the Birth ofHeruka." The Journal of the International Association ofBuddhist Studies" Vo1.l4.2 (1991):197-235. Das, Sarat Chandra. 1889. "Life ofSum-pa Khan-po, also styled Yeses-Dpal-hbyor, the author of the RelJumig ". Journal of the Asiatic Society of Bengal 48.1 (1889):37-84. De Rossi Filibeck. 1988. Two Tibetan Guide Books to Ti Se and La phyi. Ed. and transL by Elena De Rossi Filibeck. Monumenta Tibetica Historica Bd 4. Bonn. Dhargyey, Geshe Ngawang. 1975. "An Introduction to the Kalachakra Initiation." Tibet . Journal. VoL I, No.1 - July/September 1975. Dhararnsala. Dhargyey, Geshe Ngawang. 1985. A Commentary on the Kiilacakra Tantra. Dharamsala. Dowman, Keith. 1988. The Power-Places of Central Tibet. - The Pilgrim's Guide. London & New York. Dudjom Rinpoche. 1991. The Nyingma School of Tibetan Buddhism. Its Fundamentals and History. Vol.1: The Translations, VoL2: Reference Material. By Dudjom Rinpoche and Jikdrel Yeshe Dorje. - Translated and edited by Gyurme Dorje with the collaboration of Matthew Kapstein. Boston. Dutt, Sukumar. 1963 .. Buddhist Monks and Monasteries in India. London: Dvivedi, Vraj Vallabh. 1990. "The Utility of Tantras in Modem Times". Panels of the 7th World Sanskrit Conference, 1. ed. by lBronkhorst:32-42. Edgerton, Franklin. 1972 (1953). Buddhist Hybrid Sanskrit Grammar and Dictionary. Volume I: Grammar. Volume II: Dictionary. Delhi. Eimer, Helmut. 1974. Berichte aber das Leben des DiparpkarasrljFiii. Bonn. 1978. Bodhipiithapraq.ipa, ein Lehigedicht des AtiSa in der tibetschen Oberlieferung. Asiatische Forschungen 59. Wiesbaden. 1979. rNam thar rgyas pa. Materialen zu einer Biographie des Atisa. 1. Teil und 2. Teil. Wiesbaden. Eliot, Charles. 1921. Hinduism and Buddhism. - A Historical Sketch. VoLID. London. Evans-Wentz, W.Y. (Ed.). 1968 (1935). Tibetan Yoga and Secret Doctrines. Translated by Lama Kazi Dawa-Samdup. London. Fenner, Edward T. 1979. Rasayana Siddhi: Medicine and Alchemy in the Buddhist Tantras. Unpublished Ph. D. Dissertation at the University of Wisconsin, Madison -WI, Ferrari, Alfonsa. 1958. mK'yen-brtse's Guide to the Holy Places of Central Tibet.

219

Compiled and edited by L. Petech with the collaboration of Hugh Richardson. Serie Orientale Roma 16. Roma. Frauwallner, Erich. 1984 (1973). History ofIndian Philosophy. Vol 1. Delhi. Gellner, David N. 1989. "Hodgson's blind alley? On the so-called schools of Nepalese Buddhism." Journal of the International Association ofBuddhist Studies 12 (1989):7 -19. . 1992. Monk, Householder and Tantric Priest. - Newar Buddhism and its hierarchy of ritual. Cambridge. 2001. The Anthropology ofBuddhism and Hinduism. New Delhi. Gendun Drub, the First Dalai Lama. 1982. Bridging the Sutras and the Tantras. Compiled and translated by Glenn H. Mullin, Ithaca, NY. Geshe Lhundub Sopa, Roger Jackson &John Newman. 1985. The Wheel of Time. Kalachakra in Context. Madison,WI 1985. Getty, Alice. 1928. The Gods ofNorthern Buddhism. 2nd ed. Oxford. Glasenapp, Helmut von. 1940. Buddhistische Mysterien. Stuttgart. Gnoli, Raniero. 1972. "I1 mezzo del tempo" in Luce delle Sacre Scritture (Tantriiloka) di Abhinavagupta a cura di Raniero Gnoli. [Chapter 6 on Time, of the Tantriiloka] Torino:208-237. 1997. Pundarika, la realizzazione della conoscenza del supremo immoto. Roma. Gruschke, Andreas. 2002. "Der Jonang-orden: Grlinde flir seinen Niedergang, Voraussetzungen fur das D berdauern und aktuelle Lage." In Tibet, Past and Present. Tibetan Studies 1. PIATS 2000: Tibetan Studies: Proceedings of the Ninth Seminar of the International Association for Tibetan Studies, Leiden 2000:183-213. Goldstein-Kyaga, Katrin. 1987. Religion som etnicitet. - Om Kalachakra, en buddhistisk tibetansk ceremoni och de tibetanska flyktingarna i Europa. Studier i den pedagogiska vaven 1987:3. Stockholm. Goldstein, Melvyn C. 1983 (1975). Tibetan-English Dictionary of Modern Tibetan. Kathmandu. Grlinwedel, Albert. 1915. Der Weg nach Schambhala. Abhandlungen der Koniglich Bayerischen Akademie der Wissenschaften 29, no.3. Miinchen. Gronbold, GUnter. 1969. ~a!;laizga-yoga -Ravisrijfiana's GUlJabhiiralJi niima $aq.aizgayoga!ippani mit Text, Ubersetzung und literarhistorische Kommentar. Dr.Phil.- Dissertation. Ludwigs-Maximilian-Universitat zu MUnchen. 1982. "Materialen zur Geschichte des ~a!;laJi.ga-yoga. III. Die Guru-Reihen im buddhistischen ~a!;laIi.ga-yoga." Zentralasiatische Studien 16 (1982):337-347. 1983a. "Der sechsgliedrige Yoga des Kalacakra-tantras." Asiatische StudienEtudes Asiatiques 37.1 (1983):22-45. 1983b. "Inhaltsverzeichnisse der Gesammelten Werke Tibetisch schreibender Autoren." The Journal of the Tibet Society, Vol.3 (1983), Bloornington:27-41. 1983c. "Materialen zur Geschichte des ~a!;laIi.gayoga I. Der ~a!;laIi.gayoga im Hinduismus." Indo-Iranian Journal Vol.25 (1983):181-190. 1983d. "Materialen zur Geschichte des ~a!;laIi.gayoga. IV. Tibetische Literatur zum ~a!;laIi.ga-yoga." Wiener Zeitschriftfor die Kunde Sadasiens, und Archivefor

220

Indische Philosophie." Bd. 27 (1983): 191-199. 1984. "Materialen zur Geschichte des ~ac;iailga-yoga. II. Die Offenbarung des ~ac;iailga- yoga im Kalacakra-System." Central Asiatic Journal VoI.28.1-2 (1984):43-56. 1991. "Das Datum des Buddha nach tantrischen Texten". The Dating of the Histori cal Buddha - Die Datierung des historischen Buddha, Part 1. Ed. by H. Bechert. Gtittingen:385 - 402. 1992a. "Zwei A.dibuddha-Texte", Sanskrit-Texte aus dem buddhistischen Kanon: Neuentdeckungen und Neueditionen II. Bearbeitet von Jens-Uwe Hartmann, Klaus Wille, Claus Vogel, Gunter Grtinbold. Sanskrit-Wtirterbuch der buddhistischen Texte aus den Turfan-Funden. Beiheft 4. Gtittingen:11l-161. 1992b "Heterodoxe Lehren und ihre Widerlegung im Kalacakra.Tantra." IndoIranian Journal 35:273-297. 1995. "Weitere A.dibuddha-Texte" .In Wiener Zeitschrift fUr die Kunde Sadasiens, Bd. 34 (1995), p.45-60. 1996a. "Kriegsmaschinen in einem buddhistischen Tantra." Festschrift Dieter Schlingloff. Hrsgb. von Friedrich Wilhelm. Reinbek:63-97. 1996b. The yoga ofsix limbs - An Introduction to the History of $atJangayoga. Santa Fe. 2000. "Vom Zahneputzen zur Unsterblichkeit - Medizin und A!chernie im Kiilacakra-tantra." VividharatnakaralJtJaka - Festgabefor Adelheid Mette. Hrsg. Von C.Chojnacki, J-U Hartmann und V.M. Tschannerl. Indica et Tibetica Bd. 37 Swisttal-Odendorf: 283-296. Guenther, Herbert V. 1963. The Life and Teachings ofNiiropa. London. 1969. The Royal Song ofSaraha. Seattle and London. 1976. Buddhist Philosophy in theory and Practice. Boulder & London. Gang, Peter. 1988. Das Tantra der Verborgenen Vereinigung- Guhyasamiija-Tantra. Aus dem Sanskrit libersetzt und herausgegeben von Peter Gang. Munchen. Haarh, Erik. 1969. The Yar-lun dynasty. Ktibenhavn. Hahlweg, Klaus. 1965. "Der Dhanyakataka-Stiipa." Zeitschrift der Deutschen Morgenlandischen Gesellschaft 115 (1965):320-326. Hammar, Urban. 1992. "Religion och politik i Tibet." i David Westerlund (ed), Sekularism ifragasatt. Tro och Tanke 1992:4. Uppsala. Har Dayal. 1932. The Bodhisattva Doctrine in Buddhist Sanskrit Literature. London. Harrison, Paul. 1992. "Is the Dharma-kaya the Real 'Phantom Body' of the Buddha?" Journal of the International Association afBuddhist Studies 15.1 (1992): 44-94. Harrison, Paul and Helmut Eimer. 1997. "Kanjur and Tanjur Sigla: A proposal for Standardization." Tibetan Studies, PlATS, Graz 1995. Vol. I. Wien 1997:xvii-xx. Hartzell, James Francis. 1997. Tantric Yoga: A Study of the Vedic Precursors, Historical Evolution, Literatures, Cultures, Doctrinal, and Practices of the 11'" century Kasmirf Saivite and Buddhist Unexcelled Tantric Yogas. PhD. Dissertation. Columbia University. New York. Hazra, Kanai La!. 1986. The Adi-Buddha. Delhi. Henss, Michael. 1985. Der Kalachakra Tantra. Zurich. Hodgson, Brian H. 1874a (1828). "Sketch of Buddhism, derived from the Bauddha

221

scriptures of Nepal." Repr. in Essays of the languages, literature, and religion ofNepal and Tibet. London 1874, repro New Delhi 1972:35-65. I 874b. Notes of the Adi Buddha and of the seven mortal Buddhas." Essays of the languages, literature and religion ofNepal and Tibet. London: 115-120. Repr. New Delhi 1972:83-88. Hoffinann, Helmut. 1951. "Literarhistorlsche Bemerkungen zur Sekkodesati'kli des Nligaplida." Beitrtige zur indischen Philologie und Altertumskunde. Festschrift Walther Schubring, Alt- und Neu-indische Studien 7. Hamburg: 140-147. - 1958. "Manicheism and Islam in the Buddhist Klilacakra System." Proceedings of the IX th International Congress for the History ofReligions. Ed. by Zwi Werblovsky. Tokyo:96-99. 1961. The Religions of Tibet. New York. 1964. "Das Klilacakra, die letzte Phase des Buddhismus in Indien." Saeculum 15 (1964):125-131. 1967. "Die Polarltatslehre des spaten Buddhismus." Eranos-Jahrbuch 36 1967 (1968):361-378. 1969/1972. "Klilacakra Studies. I. Manicheism, Christianity, and Islam in the Klilacakra Tantra", Central Asiatic Journal 13 (1969):52-73; and "Addenda et Corrigenda", CAJ 15 (1972):198-20l. 1973. "Buddha's Preaching of the Klilacakra Tantra at the Stiipa of Dhlinyakataka." German Scholars on India. Volume 1. Varanasi:136-140. 1975. Tibet. A Handbook. Bloomington. 1990, "Early and Mediaeval Tibet." The Cambridge History ofEarly Inner Asia. Cambridge:371-399. Hookham, S.K. 1991. The Buddha Within - Tathiigatagarbha Doctrine According to the Shentong Interpretation of the Ratnagotravibhaga. New York. Hummel, Siegbert. 1958. "Anmerkungen zur Apokalypse des Lamaismus." Archiv Orientaln{ 26.2 (1958):186-196. Imaeda, Yoshiro. 1987. "Peintures Cosmiques du Bhoutan." In Gnoli & Lanciotti (eds.) 1985-88. Orientalia Iosephi Tucci Memoriae Dicata. Serle Orientale Roma, LVI, 3 vols. Roma. VoL2, 1987:627-634. Jackson, David P. & Janice A. Jackson. 1984. Tibetan Thangka Painting. London. Jonas, Hans. 1963. The Gnostic Religion: The Message of the Alien God and the Beginnings of Christianity. Boston., Jaschke, H.A. 1972 (1881). A Tibetan-English Dictionary. London. Kalachakra Initiation. - Madison 1981. First edition. Madison 1981. Kalachakra Initiation. - Switzerland 1985. Second, revised edition. Winterthur 1985. KaluRinpoche. 1986. The Kalachakra Empowerment. Vancouver. Kalupahana, David J. 1991. Mulamadhyamakakiirikii ofNagarjuna - The Philosophy of the Middle Way. Introduction, Sanskrit Text, English Translation and Annotation. Delhi. K'am-triil Rinpoche, Gar-je (Khamtrul Rinpoche). 1978. "A Geography and History of Shambhala." Trans!. by Sherpa Tulku and Alexander Berzin. The Tibet Journal 3, no.3 (1978):3-11. Kapstein, Matthew. 1992. Introduction and Catalogue. To: The Collected Works of Dol-

222

po-pa Shes-rab rgyal-mtshan. Delhi. Karmay, Samten G. 1980. "The Ordinance oflHa bla-ma Ye-shes-'od". Tibetan Studies in Honour ofHugh Richardson. Warminster: 150-162. Kollmar-Paulenz, Karenina. 1992/93. "Utopian Thought on Tibetan Buddhism: A Survey of the Sambhala Concept and its Sources." Studies in Central & East Asian Religions Vo!' 5/6 (1992/93):78-96. 1997. "Sambhala, eine tibetisch-buddhistische Utopie" Proceedings of the International Association of Tibetan Studies, Volume 1- Tibetan Studies. Wien:535-542. Kuijp, Leonard W.J. van der. 1994. "Apropos of Some Recently Recovered Texts Belong ing to the Lam 'Bras Teachings of the Sa skya pa and Ko brag pa." Journal of the International Association ofBuddhist Studies 17.2 (1994): 175-20 1. 1996. "Tibetan Historiography." Tibetan Literature: Studies in Genre. Ed. by Jose Ignacio Cabezon & Roger R. Jackson. Ithaca:39-56. Kvrerne, Per. 1975. "On the Concept of Sahaja in Indian Buddhist Tantric Literature." Temenos 11 (1975):88-l35. Kongtrul, Jamgon Lodro Taye. 1995. Myriad Worlds, Buddhist Cosmology in Abhidharma, Kiilacakra and Dzog-chen. Ithaca. Lalou, Marcelle. 1933. Repertoire du bsTan- 'gyur. Paris. 1957. "Les Religions du Tibet." Mythes et Religions 35. Paris:48-49. Lamotte, Etienne. 1960. "MaiijusrI." In T'oung Pao 48 (1960):1-96. 1958. Histoire du bouddhisme Indien. Louvain. Larson, Gerald J. 1979. Classical Siil!1khya. Delhi: Motilal Banarsidass. Lauf, DetiefIngo. 1976. Tibetan Sacred Art. 1979. Eine Ikonographie des tibetischen Buddhismus. Graz. Laufer, Berthold. 19l3. "The Application of the Tibetan Sexagenery Cycle." T'oung Pao 14 (19l3):569-96. Leidy, Denise Patry and Robert A.F. Thurman. 1997. Mandala - The Architecture of Enlightenment. London. Lessing, Ferdinand & Wayman, Alex, (Transl.). 1968. Mkhas grub rje 's Fundamentals of the Buddhist Tantras. The Hague. Lessing, Ferdinand. 1942. Yung-Ho-kung. An Iconography of the Lamaist cathedral in Peking. With notes on the Lamaist mythology and cult. Reports from the Scientific Expedition to the North-western Provinces of China under the leadership of Dr Sven Hedin, Pub!. 38, VIII, Ethnography 6, Stockholm. Lopez, Jr., Donald. 1998. Shangri La. Tibet in the west. ChicagolLondon. MacDonald, Ariane. 1962. Le Mal}qala de Maf!jusrfmulakalpa. Paris. 1970. "Le Dhanyakataka de Man-luns Guru." Bulletin de nicole Francaise de l'Extreme Orient 57 (1970):169-213. Imaeda, Y. & others. 1977. Essais sur l'art du Tibet. Paris. Makransky, John. 1990. Controversy over Dharmakiiya in Indo-Tibetan Buddhism: An historical-critical analysis of "Abhisamayalamkara" chapter 8 and its commentaries in relation to the large "Pr~iiapliramita Satra" and the Yogaclira tradition. Part 1 &2. [Unpublished Doctoral Dissertation at the University of Wisconsin - Madison] 1997. Buddhahood Embodied. - Sources of Controversy in India and Tibet.

223

New York. Malalasekera, G.P. & Shinten Sakai & Kanyii Kabese. 1961-65. "Adi-Buddha". Encyclopaedia ofBuddhism VoL L Colombo:213-219. de Mallmann, Marie-Therese. 1975. Introduction al'iconographie du tantrisme . bouddhique. Paris. Mathes, Klaus-Dieter. 2000. "Taranatha's Presentation of trisvabhiiva in the gian ston sfiin po". Journal of the International Association ofBuddhist Studies 23.2, p.195-223. Mitra, Rajendralala. 1971 (1882) The Sanskrit Buddhist Literature ofNepal. Calcutta. Modi, P.M. 1932. A~ara. A Forgotten Chapter in the History ofIndian Philosophy. Baroda. Mullin, Glenn H. 1985. Bridging the Sutras and the Tantras. A collection often minor works by Gyalwa Gendun Drub (dGe- 'dun grub) the First Dalai Lama. Ithaca NY. - 1991. The Practice ofKalachakra. Ithaca, NY: Snow Lion Publications. Monier-Williams, Sir Monier. 1976 (1899). A Sanskrit-English Dictionary. Delhi. Montell, Giista. 1942. Bland gudar och vanliga miinniskor. Stockholm. Nakamura, Hajime. 1980. Indian Buddhism, a Survey with bibliographical Notes. Tokyo. Naropa. 1994. Iniziazone - Kiilacakra. A cura di Raniero Gnoli & Giacomella Orofino. [Roma]. Naudou, Jean. 1968. Les Bouddhistes Kasmiriens au Moyen Age. Paris. Nebesky-Wojkowitz, Rene de. 1956. Oracles and Demons of Tibet. 's-Gravenhage. Newman, John R. 1985. "A Brief History ofthe Kalachakra." in Geshe Lhundup Sopa & Roger Jackson & John Newman. The Wheel of Time. Madison:51-84. 1987a. The Outer Wheel of Time. - Vajrayiina Buddhist Cosmology in the Kiilacakra Tantra. Unpublished PhiLDr. Dissertation. University of Wisconsin, Madison. 1987b. "The Paramadibuddha (the Kalacakra mulatantra) and its Relation to the early Kalacakra Literature". Indo-Iranian Journal 30 (1987):93-102. 1988. "Buddhist Sanskrit in the Kalacakra Tantra." Journal of the International Association ofBuddhist Studies 11.1(1988):123-140. 1992. "Buddhist Siddha:nta in the Kalacakra Tantra". in Wiener ZeitschrififUr die Kunde Siidasiens und Archiv fUr Indische Philosophie. Bd.36 1995. "Eschatology in the Wheel of Time Tantra." Buddhism in Practice. Ed. by Donald Lopez. Princeton:284-289. 1996. "Itineraries to Sambhala." Tibetan Literature: Studies in Genre. Ed. by Jose I Cabezon & Roger R. Jackson. Ithaca:485-499. 1998a. "The Epoch of the Kalacakra Tantra".Indo-Iranian Journal 41 (1998):319349. 1998b. "Islam in the Kalacakra Tantra". Journal of the International Association of Buddhist Studies 21.2 (1998):311-371. 2000. "Vajrayoga in the Kalacakra Tantra." Tantra in Practice. Ed. by David Gordon White. Princeton and Oxford:587-594. Nihom, Max. 1994. Studies in Indian and Indo-Indonesian Tantrism: The Kufijarakarnadharmahettora and the Yogatantra. Wien. Niyogi Balslev, Anindita. 1983. A Study of Time in Indian Philosophy. Wiesbaden. Oppitz, Michael. 1974. "Shangri-La, Ie panneau de marque d'un flipper: analyse

224

semiologique d'un mythe visuel." L 'Homme 14, nos.3-4 (1974):59-83.

Orientalia Iosephi Tucci Memoriae dictata. 1985, 1987 1988. Vol.1-3. Ed. by G Gnoli and 1. Lanciotti. Roma. Orofmo, Giacomella. 1994a. Sekodde§a -A Critical Edition of the Tibeten Translation. With an Appendix by Raniero Gnoli on the Sanskrit Text. Roma. 1994b. "Divination with mirrors. Observations on simile found in the Kalacakra literature." Tibetan Studies. Proceedings of the 6th Seminar of the International Association for Tibetan Studies Fagernes 1992. Volume 2. Ed. by Per Kvaeme.Oslo:612-628. and R. Gnoli 1994c. Niiropii. Iniziazione Kiilacakra. A cura di Raniero Gnoli e Giacomella Orofmo. [Trans!. of the Sekodde§atfka into Italian]. Roma. 1997. "Apropos of Some Foreign Elements in the Kalacakra-tantra". PlATS, Graz 1995, Volume II. Tibetan Studies. Wien:717-724. Pelliot, Pau!' 1913. "Le cycle sexagenaire dans la chronologie tibetaine." Journal Asiatique 11, no.1 (1913):633-67. Petri, Winfried. 1966. "Tibetan Astronomy." Vistas in Astronomy 9 (1968):159-64. 1988. "Die Astronomie im Kalacakralaghutantra." In Tibetan Studies, Vol.2, Ed. by H.Uebach & J.1. Panglung. Miinchen. Petech, Luciano. 1980. "Ya-ts'e, Gu-ge, P'u-rali: A New Study." Central Asiatic Journal 24, (1985):85-11 L Piatigorsky, A. "Some Observations on the Notion of Tathiigatagarbha." The Buddhist Forum Volume III 1991-1993. Ed. by Tadeusz Skorupski & Ulrich Pagel. London. Pingree, David. 1981. Jyoti!;fiistra: Astral and Mathematical Literature. A History of Indian Literature 5.4. Wiesbaden. Pot!, P.H. 1966. Yoga and Yantra. Leiden:57-61 Prasad, H.S. (Ed.) 1991. Essays on Time in Buddhism. Delhi. Prasad, H.S. 1985. The Buddhist Philosophy of Time. Delhi. Ray, Nihar-Ranjan. 1936. Sanskrit Buddhism in Burma. Amsterdam Ray, Reginald. 1974. "Understanding Tantric Buddhism: Some questions of Method." Journal ofAsian Studies, Vo!' 34.1 (1974). Regamey, Constantin. 1938. Three Chapters from the Samiidhirajasutra. Warszawa. Reigle, David. 1986. The Lost Kiilacakra Milia Tantra on the Kings ofSambhala. Kalacakra Research Publications, No.1, Feb. 1986. Talent, Oregon. Richardson, Hugh. 1980. "The first Tibetan Chos-Byung". The Tibet Journal 5 (1980): 6273. Rigzin, Tsepak. 1986. Tibetan-English Dictionary ofBuddhist Terminology. Dharamsala. Rhie, Marilyn M. & Thurman, Robert A.F. 1996. The Sacred Art of Tibet. New York. Roerich, George N.1925. Tibetan Paintings. Paris. 1931. Trails to Inmost Asia. New Haven & London. 1933. "Studies in the Kalacakra." Journal ofUrusvati. Vo!' 2 (1933), p.l8-22. 1959. Biography ofDharmaswamin - A Tibetan Monk Pilgrim. Original Tibetan Text deciphered and translated by George Roerich. Patna. 1983-87 Tibetan-Russian-English Dictionary with Sanskrit Parallels.

225

Y.Parfionovich and V.Dylokova (eds.). Moscow. 1949/53. "The Blue Annals". Vois. I and II. (A translation of 'Gos lo-tsa-ba gZhonnu-dpal's Deb-ther ngon-po). Reprint 1976. New Delhi. Roerich, Nicholas. 1928. Heart of Asia. New York. Roerich, Nicholas. 1985 (1930). Shambhala. New York. Ruegg, David Seyfort. 1963. "The Jo-nang-pas: A School of Buddhist Ontologists Accord ing to the Grub-mtha' -shel-gyi-me-Iong." Journal of the American Oriental Society 83 (1963):73-91.s 1966. The Life ofBu-ston Rin-po-che. Edited and trans!. by D.S. Ruegg. Roma. 1969 La tMorie du tathiigatagarbha et du gotra. Paris. 1981. "Deux problemes d'exegese et de pratique tantriques." In Tantric and Taoist Studies in Honor ofProfessor R.A. Stein. Vo!' I Melanges Chino is et Bouddhiques 20, p.212-226. 1992. Buddha-nature, Mind and the Problem of Gradualism in Comparative Perspective - On the Transmission and Reception ofBuddhism in India and Tibet. New Delhi. 1995. L 'ordre spirituel et ordre temporel dans la pensee bouddhique de lInde et du Tibet. - Quatre conferences au College de France. Paris. Saddharma-pundarika. 1974. The Saddharma-pundarfka or The Lotus of the True Law. Trans!. by H. Kern. Delhi 1974 (1884). Sanderson, Alexis. 1994. "Vajrayana: Origin and Function". Proceedings: 'Buddhism into the Year 2000'. The Dhammakaya Foundation, KhIong Sam. Sang-po, Khetsun. 1973-79. Biographical Dictionary of Tibet. VoU-XI. Dharamsala. Saillq:tyayana, Rahula. 1934. "Recherches bouddhiques.l. Les origines du Mahayana." Journal Asiatique 25 (1934):195-205. Saraydarian, Torkom. 1989. Legenden om Shambhalla. Ungshyttan. [Original: Gita Saray darian, The Legend of Shambhalla.l976]. Schayer, Stanislav. 1938. Contributions to the problem of Time in Indian Philosophy. Krakow. Scheftelowitz, Isidor. 1929. Die Zeit als Schicksalsgottheit in der Indischen und Iranischen Religion. Beitrage zur Indische Sprachwissenschaft Religion 1-5. Stuttgart. Schiefuer, Anton. 1970. Tiiraniitha's History ofBuddhism. Tibetan text edited with German translation. 2 vols. St Petersburg 1868-69. English version, based on the German. Simla 1970. Schlagintweit, Emi!. 1863. Buddhism of Tibet illustrated by literary documents and objects of religious worship. Leipzig. 1897. "Die Berechnung der Lehre. Eine Streitschrift zur Berichtigung der buddhistischen Chronologie verfasst im Jahre 1591 von Suresamatibhadra [IHadbang -blo-gros bzang-po]. Aus d. Tibetischen iibersetzt von Emil Schlagintweit."· Abhandlungen der k6niglich bayerischen Akademie der Wissenschaften. Philosophisch-philologische Classe. 20 (1897):589-670. Schubert, Johannes. 1953. Das Wiinschgebet zur Shambhala. Deutsche Akadernie der Wissenschaften zu Berlin. Institut fur Orientforschung.- Mitteilungen des Instituts flir Orientforschung Band I. 1953. Berlin.

226

1954. "Das Reis-Mandala. Ein tibetisches Ritualtext." In Asiatica. Festschrift F. Weller. Leipzig. Schuh, Dieter. 1973. Untersuchungen zur Geschichte der tibetischen Kalenderrechnung. VOHD, supplementband·16. Wiesbaden. Schumann, Hans Wolfgang. 1986. Buddhistische Bilderwelt. - Ein ikonographisches Handbuch des Mahayana- und Tantrayana Buddhismus. Kaln. Serkong Rinpoche. 1984. Teaching on Kalachakra. Transl by Alexander Berzin 24 tapes. Madison. Sferra, Francesco. 2000. The Sadangayoga by Anupamarakshita. Serie Orientale Roma 85. Roma Shahidullah, M. 1928. Les chants mystiques de Kanha et de Saraha. Paris. Shakabpa, T.W.D. 1984 (1967). Tibet: A Political History. New York. Shastri, Hara Prasad. 1917. A Descriptive Catalogue of Sanskrit Manuscripts in the Government Collection Under the Care of the Asiatic Society of Bengal Vo!. 1, Buddhist Manuscripts. Calcutta. Shrfchakrasambhara Tantra-ABuddhist Tantra. 1919. Ed. and trans!. by Kazi DawaSamdup. In: Tantrik Texts. Vo!' VII Ed. by Arthur Avalon. London/Calcutta. Simonsson, Nils. 1955. Indisk Filosofi - Sarrzkhya. Inledning och aversattning av Nils Simonsson. Stockholm. Snellgrove, David L. 1959. The Hevajra-Tantra vo!'I-2. London. - 1987. Indo-Tibetan Buddhism. Vol.1-2. Boston. & T.Skorupski 1980. "Part III - Biography of Rin-chen bZang-po." The Cultural Heritage ofLadakh. Vol. 2. Zangskar and the Cave Temples of Ladakh. Warminster:83-116. Sopa, Geshe Lhundrup. 1985. "The Subtle Body in Kalachakra." In Geshe Lhundrup Sopa, Roger Jackson & John Newman, The Wheel of Time - The Kalachakra in Context. Madison: 133-158. Also published as "An Excursus on the Subtle Body in Tantric Buddhism." The Journal of the International Association ofBuddhist Studies. VoL6,no.2 (1982). Stael-Ho1stein, Baron Alexander von. 1935/36. "On the Sexagenery Cycle of the Tibetans." Monumenta Serica 1 (1935/36):277-314. Stchoupak,N., Nitti,L. et L. Renou. 1972 (1932). Dictionnaire Sanskrit-Fran~ais. Paris. Steams, Cyrus R. 1995. "Dol-po-pa Shes-rab rgya1-mtshan and the Genesis of the gzhanAnnales du Musee Guimet. Paris. Annales du Musee Guimet. Paris. 1996a. The Buddhafrom Dol po and His Fourth Council of the Buddhist Doctrine. Ph.Dr. Dissertation at the University of Washington. Seattle. 1996b. "The Life and Tibetan Legacy of the Indian MahapaI).<;lita Vibhiiticandra." Journal of the International Association ofBuddhist Studies 19.1 (1996): 127-171. 1999. The Buddhafrom Dolpo. -A Study of the Life and Thought of the Tibetan Master Dolpopa Sherab Gyaltsen. New York. Stein, R.A. 1981 (1962). La Civilisation Tibetaine. Paris. Stein, R.A. 1956. L 'Epopee Tibetaine de Gesar - Dans sa version Lamaique de Ling. Anna1es du Musee Guimet. Paris. Strickmann, MicheL 1996. Mantras et mandarins. -Le bouddhisme tantrique en Chine. Paris. -

227

Stril-Rever, Sofia. 2000. Tantra de Kalachakra. Le Livre dlt Corps subtil. Paris 2000. 2001. L'Initiation de Kalachakra pour la paix dans Ie monde. (Texte integral du ritueL) Paris. 2002. Kalachakra - Guide de ['Initiation et du Guru Yoga. Enseignements de Sa Saintete Ie Dalai Lama et de Jhado Tulku Rinpoche.Paris. Strom, Axel. 1989. The questfor grace. -Identification and Cultural Continuity among Tibetan Refugees in India. Cando Polit-avhandling. Department of Social Anthropology at the University of Oslo. Subrahrnanyarn, B. 2001. Vajrayana Buddhist Centres in South India. Delhi. Takahashi, Eiji. 1981. "Guhyasamaja-tantra" English translation. Some Studies in Indian History. Funasbashi, Chiba:135-226. Taranathae. 1868/69. "Geschichte des Buddhismus in Indien." Tibetische text editiert und aus dem Tibetischen Ubersetzt von AntonSchiefner. St. Petersburg. Thakur, Laxman S. 1994. "A Tibetan Inscription by IHa Bla-ma Ye-shes-'od from dKor (sPu) rediscovered." Journal of the Royal Asiatic Society, Third series 3,4 (1994):369-375. 1997. "Tibetan Historical Inscriptions from Kinnaur and Lahaul-Spiti: A Survey of Recent Discoveries." PlATS, Graz 1995, Volume II, Tibetan Studies. Wien:967979. 2001. Buddhism in the Western Himalaya -A Study of the Tabo Monastery. New Delhi. Tibet Handbook. 1999. Footprint Tibet Handbook, 2nd Edition. By Gyurme DOIje. Bath. Tibetan Mandalas. 1983. Tibetan Mandalas: The Ngor Collection. VoLl Explanation and Iconography. VoL2 Colour Plates. Ed. by bSod narns rgya mtsho. Tokyo 1983. Tibetan Mandalas. 1995. Tibetan MalJq.alas (Vajraviilr and Tantra-samuccaya). By Prof. Dr. Raghu Vira and Prof. Dr. Lokesh Chandra. Sata-Pifaka Series, Indo-Asian Literatures Volume 383. New Delhi. Toffin, Gerard. 2000. Entre hindouisme et bouddhisme: la religion newar, Nepal. LouvainLa-Neuve. Tola, Fernando & Carmen Dragonetti. 1980. "Anaditva or Beginninglessness in Indian Philosophy." Annals of the Bhandarkar Oriental Research Institute 61 (1980): 120. Trimondi, Victor und Victoria. 1999. De;' Schatten des Dalai Lama. Sexualitiit, Magie und Politik im tibetischen Buddhismus. [The authors names are pesudonyms for Hermann and Mariana Rottgen]. DUsseldorf. Trimondi, Victor and Victoria. 2003. The Shadow of the Dalai Lama. English Internet edition 2003. Trimondi, Victor und Victoria. 2002. Hitler - Buddha - Krishna - Eine unheilige Allianz yom Dritten Reich bis heute. Dilsseldorf. Tripathi, Ramashankar. 1977. History of Ancient India. First ed. 1942. Delhi. Trungpa, Chogyam 1975: Visual Dharma. Berkeley. Tsuda, Shinchi. 1974. The SmJlvarodaya-tantra (Selected Chapters). Tokyo. Tucci, Giuseppe. 1933. Rin c'en bzan po e la rinascita del Buddhismo nel Tibet intorno al mille. Indo-Tibetica II. Roma. 1988. The Temples of Western Tibet and their Artistic Symbolism.

228

Tsaparang. (English Version ofIndo-Tibetica m.2, Rome 1935) Ed. by Lokesh Chandra. New Delhi. 1980 (1949). Tibetan Painted Scrolls. 2 vols. Rome; New edition Kyoto 1980. & Walther Reissig. 1973. Les religions du Tibet et de la Mongolie. Paris. US Air Force Operational Navigation Charts. ONC G-7, ONC G-8, ONe H-9, ONC R-I0. Cartographical information from the 1960s. Published by the US Air Force 1966 Waddell, L.A. 1895 (1972) The Buddhism of Tibet or Lamaism. London. Wallace, Vesna A. 1995. The Inner Kiilacakratantra: A Buddhist Tantric. View of the Individual. Ph.D. Dissertation. University of California, Berkeley. 1995/96. "Buddhist Tantric Medicine in the Kalacakratantra." The Pacific World: lournal of the Institute ofBuddhist Studies 11/12 (1995/96):155-174. 2001. The Inner Kiilacakratantra -A Buddhist Tantric View of the Individual. Oxford. Vallee Poussin, Louis de lao 1908. "Adibuddha". Encyclopaedia ofReligion and Ethics, Vo!' 1. Edinburgh:93b-l00b. Wayman, Alex. 1973. The Buddhist Tantras: Light on Indo-Tibetan Buddhism Esotericisrn. New York. 1977. Yoga of the Guhyasamiijatantra. Delhi. 1985. Chanting the Names ofMafijusrf. The Manjusri-niima-smigiti. Boston, London. Verhufen, Gregor. 1995. Tibet und seine Nachbarn. Der Index zur neuen Karte. Bonn.[The map]: Bod rang skyong ljongs srid 'dzin sa kul gyi sa bkra. Produced in China198I. Vogel, Claus. 1964. "On Tibetan Chronology". Central Asiatic Journal 9 (1964):224-238. Vostrikov, A.I. 1970. Tibetan Historical Literature. Trans!. by Rarish Chandra Gupta. Soviet Indo logy Series, no.4. Calcutta. Wintemitz, Moritz. 1920. Geschichte der Indischen Literatur. 2Bd. Die Buddhistische Litteratur und die heiligen Texte derlainas. [Die Litteraturen des Ostens in Einzeldarstellungen. 9:2]. Leipzig. Wylie, Turrell V. 1957. A Place-Name Index to George N. Roerich 's Translation of the Blue Annals. Serie Orientale Roma15. Rome. 1962. The Geography of Tibet according to the 'Dzam-gling rgyas-bshad. Tibetan text and English translation. Serie Orientale Roma 25. Rome. 1970a. A Tibetan Religious Geography ofNepal. Serie Orientale Rorna 42. Roma. 1970b. "Was Christopher Columbus from Shambhala?" Bulletin of the Institute of China Border Area Studies, no. 1 (1970):24-33. 1982. "Dating the death ofNanipa" in L.A. Rercus et al. (ed.), Indological and Buddhist Studies. Canberra.

3. Unpublished sources. Berzin, Alexander 1985. Kalachakra. Unpublished lecture manuscript. Aryatara Institute. Bloomington 1999: About the Kalacakra-initiation by Dalai Lama in Bloomington, Indiana 1999. www.tibetancc.org 2004-03-10 Buddhaline website run by Sofia Stril-Rever; www.buddhaline.net 2005-04-09

229

Chushi Gangdruk. The history of Chushi Gangdruk - Kahichakra initation. www.chushigangdmk.org 2005-04-10

Tibetan Government in Exile's official Homepage. www.tibet.com 2004-04-15 International Kalachakra Network. www.kalacakranet.org 2005-04-10 Kalachakra for World Peace, October 11-23, 2002 in Graz, Austria. The Internet site of the organizing committe, Kalachakra Office, Graz. www.kalachakra-graz.at 2005-04-10 Kalachakra for World Peace, April 2004 in Toronto, Canada. www.kalacha\ga04.c.l\2005-04-10 Magee, Mike 1995. Time and the Kalachakra. www.hubcom.comlastrologylkalcja.hull 2005-04-10 Rochester 1997. Kalachakra 1997 - An invitation to participate in a Kalachakra Initiation in Rochester, NY July 22-28, 1997. Amitabha Foundation. www.giant.netipeopleijstraitiamitabhalkalacakra.htm 2002-02-10

Trimondi, Victor and Victoria - www.trimondi.de 2004-02-15 World Tibet Network News. Published by The Canada Tibet Committee. By Brian Given, Conrad Richter, Nima DOljee, Tseten Samdup and Thubten Samdup. wtn-editorsi£imBET.cA and WTN-L@LISTS.MCGlLL.CA All the publications from WTN can be found at www.libet.calwtnarchive 2005-04-09

Source

https://epdf.tips/studies-in-the-kalacakra-tantra-a-history-of-the-kalacakra-in-tibet-and-a-study-.html